Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TRIM32 Monoclonal Antibody | anti-TRIM32 antibody

TRIM32 (E3 Ubiquitin-protein Ligase TRIM32, 72kD Tat-interacting Protein, Tripartite Motif-containing Protein 32, Zinc Finger Protein HT2A, HT2A) (HRP)

Gene Names
TRIM32; HT2A; BBS11; TATIP; LGMD2H; LGMDR8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM32; Monoclonal Antibody; TRIM32 (E3 Ubiquitin-protein Ligase TRIM32; 72kD Tat-interacting Protein; Tripartite Motif-containing Protein 32; Zinc Finger Protein HT2A; HT2A) (HRP); anti-TRIM32 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E5
Specificity
Recognizes human TRIM32.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3715
Applicable Applications for anti-TRIM32 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa105-205 from TRIM32 (NP_036342) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of TRIM32 expression in transfected 293T cell line by TRIM32 monoclonal antibody Lane 1: TRIM32 transfected lysate (72kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of TRIM32 expression in transfected 293T cell line by TRIM32 monoclonal antibody Lane 1: TRIM32 transfected lysate (72kD). Lane 2: Non-transfected lysate. )

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIM32 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIM32 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TRIM32 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TRIM32 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TRIM32 over-expressed 293 cell line, cotransfected with TRIM32 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM32 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TRIM32 over-expressed 293 cell line, cotransfected with TRIM32 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM32 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-TRIM32 antibody
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Product Categories/Family for anti-TRIM32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tripartite motif containing 32 (TRIM32), transcript variant 1, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 32
NCBI Official Symbol
TRIM32
NCBI Official Synonym Symbols
HT2A; BBS11; TATIP; LGMD2H; LGMDR8
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM32
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM32
UniProt Gene Name
TRIM32
UniProt Synonym Gene Names
HT2A
UniProt Entry Name
TRI32_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM32: Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo. Defects in TRIM32 are the cause of limb-girdle muscular dystrophy type 2H (LGMD2H); also known as muscular dystrophy Hutterite type. LGMD2H is an autosomal recessive degenerative myopathy characterized by pelvic girdle, shoulder girdle and quadriceps muscle weakness. Clinical phenotype and severity are highly variable. Disease progression is slow and most patients remain ambulatory into the sixth decade of life. Defects in TRIM32 are the cause of Bardet-Biedl syndrome type 11 (BBS11). Bardet-Biedl syndrome (BBS) is a genetically heterogeneous, autosomal recessive disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. Secondary features include diabetes mellitus, hypertension and congenital heart disease. A relatively high incidence of BBS is found in the mixed Arab populations of Kuwait and in Bedouin tribes throughout the Middle East, most likely due to the high rate of consaguinity in these populations and a founder effect. Belongs to the TRIM/RBCC family.

Protein type: Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system; Ligase

Chromosomal Location of Human Ortholog: 9q33.1

Cellular Component: cytoplasm; striated muscle thick filament; cytosol; nucleus

Molecular Function: protein binding; ubiquitin binding; protein self-association; myosin binding; zinc ion binding; translation initiation factor binding; RNA binding; Tat protein binding; transcription coactivator activity; ubiquitin-protein ligase activity; ligase activity

Biological Process: fat cell differentiation; regulation of interferon type I production; positive regulation of neurogenesis; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein polyubiquitination; positive regulation of proteolysis; protein ubiquitination during ubiquitin-dependent protein catabolic process; protein ubiquitination; positive regulation of cell cycle; positive regulation of cell growth; activation of NF-kappaB transcription factor; negative regulation of viral transcription; negative regulation of fibroblast proliferation; positive regulation of interferon type I production; positive regulation of protein catabolic process; innate immune response; positive regulation of transcription factor activity; positive regulation of neuron differentiation; response to UV; positive regulation of cell migration

Disease: Muscular Dystrophy, Limb-girdle, Type 2h; Bardet-biedl Syndrome 11

Research Articles on TRIM32

Similar Products

Product Notes

The TRIM32 trim32 (Catalog #AAA6155531) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM32 (E3 Ubiquitin-protein Ligase TRIM32, 72kD Tat-interacting Protein, Tripartite Motif-containing Protein 32, Zinc Finger Protein HT2A, HT2A) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM32 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM32 trim32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM32, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.