Mouse anti-Human, Mouse TNFSF12 Monoclonal Antibody | anti-TNFSF12 antibody

TNFSF12 (Tumor Necrosis Factor Ligand Superfamily Member 12, APO3 Ligand, APO3L, DR3LG, TNF-related Weak Inducer of Apoptosis, TWEAK, UNQ181/PRO207) (HRP)

Cat. Num. AAA6155457

• Gene Names: TNFSF12; APO3L; DR3LG; TWEAK; TNLG4A
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNFSF12; Monoclonal Antibody; TNFSF12 (Tumor Necrosis Factor Ligand Superfamily Member 12; APO3 Ligand; APO3L; DR3LG; TNF-related Weak Inducer of Apoptosis; TWEAK; UNQ181/PRO207) (HRP); anti-TNFSF12 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H3
• Specificity: Recognizes human TNFSF12. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TNFSF12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa49-134 from TNFSF12 (AAH19047) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.57kD).)

Testing Data

(Detection limit for recombinant GST tagged TNFSF12 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TNFSF12 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 33874709
• NCBI GeneID: 8742
• Molecular Weight: 36,589 Da
• NCBI Official Full Name: Homo sapiens tumor necrosis factor (ligand) superfamily, member 12, mRNA
• NCBI Official Synonym Full Names: tumor necrosis factor superfamily member 12
• NCBI Official Symbol: TNFSF12
• NCBI Official Synonym Symbols: APO3L; DR3LG; TWEAK; TNLG4A
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 12
• Protein Family: Tumor necrosis factor ligand superfamily

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants. Some transcripts skip the last exon of this gene and continue into the second exon of the neighboring TNFSF13 gene; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]