Mouse anti-Human SIK1 Monoclonal Antibody | anti-SIK1 antibody

SIK1 (Salt-inducible Kinase 1, Serine/threonine-protein Kinase SIK1, SIK-1, SIK, Serine/threonine-protein Kinase SNF1-like Kinase 1, Serine/threonine-protein Kinase SNF1LK, SNF1LK, MSK) (HRP)

Cat. Num. AAA6154967

• Gene Names: SIK1; MSK; SIK; SIK-1; SIK1B; SNF1LK
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SIK1; Monoclonal Antibody; SIK1 (Salt-inducible Kinase 1; Serine/threonine-protein Kinase SIK1; SIK-1; SIK; Serine/threonine-protein Kinase SNF1-like Kinase 1; Serine/threonine-protein Kinase SNF1LK; SNF1LK; MSK) (HRP); EC=2.7.11.1; anti-SIK1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C12
• Specificity: Recognizes human SIK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SIK1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa1-101 from human SIK1 (AAH38504) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SIK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SIK1 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-SIK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23620491
• NCBI GeneID: 150094
• Molecular Weight: 85KD
• NCBI Official Full Name: Homo sapiens salt-inducible kinase 1, mRNA
• NCBI Official Synonym Full Names: salt inducible kinase 1
• NCBI Official Symbol: SIK1
• NCBI Official Synonym Symbols: MSK; SIK; SIK-1; SIK1B; SNF1LK
• NCBI Protein Information: serine/threonine-protein kinase SIK1
• Protein Family: Serine/threonine-protein kinase

NCBI Description

This gene encodes a serine/threonine protein kinase that contains a ubiquitin-associated (UBA) domain. The encoded protein is a member of the adenosine monophosphate-activated kinase (AMPK) subfamily of kinases that play a role in conserved signal transduction pathways. A mutation in this gene is associated with early infantile epileptic encephalopathy 30. [provided by RefSeq, Nov 2016]