Mouse anti-Human SCAMP3 Monoclonal Antibody | anti-SCAMP3 antibody

SCAMP3 (Secretory Carrier-associated Membrane Protein 3, Secretory Carrier Membrane Protein 3, C1orf3, PROPIN1) (HRP)

Cat. Num. AAA6154824

• Gene Names: SCAMP3; C1orf3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SCAMP3; Monoclonal Antibody; SCAMP3 (Secretory Carrier-associated Membrane Protein 3; Secretory Carrier Membrane Protein 3; C1orf3; PROPIN1) (HRP); anti-SCAMP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F6
• Specificity: Recognizes human SCAMP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1545

• Applicable Applications for anti-SCAMP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-169 from SCAMP3 (NP_005689) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged SCAMP3 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-SCAMP3 antibody

Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.

Product Categories/Family for anti-SCAMP3 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519315597
• NCBI GeneID: 10067
• NCBI Accession #: NM_005698.4
• NCBI GenBank Nucleotide #: NM_005698
• UniProt Accession #: O14828
• NCBI Official Full Name: Homo sapiens secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: secretory carrier membrane protein 3
• NCBI Official Symbol: SCAMP3
• NCBI Official Synonym Symbols: C1orf3
• NCBI Protein Information: secretory carrier-associated membrane protein 3
• UniProt Protein Name: Secretory carrier-associated membrane protein 3
• Protein Family: Secretory carrier-associated membrane protein
• UniProt Gene Name: SCAMP3
• UniProt Synonym Gene Names: C1orf3; PROPIN1
• UniProt Entry Name: SCAM3_HUMAN

NCBI Description

This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]

Uniprot Description

SCAMP3: an integral membrane of the SCAMP family. Acts as a recycling carrier to the cell surface. Functions in post-Golgi recycling pathways. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Vesicle; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: ubiquitin protein ligase binding

Biological Process: protein transport; response to retinoic acid; post-Golgi vesicle-mediated transport