Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human SCAMP3 Monoclonal Antibody | anti-SCAMP3 antibody

SCAMP3 (Secretory Carrier-associated Membrane Protein 3, Secretory Carrier Membrane Protein 3, C1orf3, PROPIN1) (Biotin)

Gene Names
SCAMP3; C1orf3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCAMP3; Monoclonal Antibody; SCAMP3 (Secretory Carrier-associated Membrane Protein 3; Secretory Carrier Membrane Protein 3; C1orf3; PROPIN1) (Biotin); anti-SCAMP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F6
Specificity
Recognizes human SCAMP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1545
Applicable Applications for anti-SCAMP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa70-169 from SCAMP3 (NP_005689) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged SCAMP3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCAMP3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SCAMP3 antibody
Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
Product Categories/Family for anti-SCAMP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
secretory carrier membrane protein 3
NCBI Official Symbol
SCAMP3
NCBI Official Synonym Symbols
C1orf3
NCBI Protein Information
secretory carrier-associated membrane protein 3
UniProt Protein Name
Secretory carrier-associated membrane protein 3
UniProt Gene Name
SCAMP3
UniProt Synonym Gene Names
C1orf3; PROPIN1
UniProt Entry Name
SCAM3_HUMAN

NCBI Description

This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]

Uniprot Description

SCAMP3: an integral membrane of the SCAMP family. Acts as a recycling carrier to the cell surface. Functions in post-Golgi recycling pathways. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Vesicle; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: ubiquitin protein ligase binding

Biological Process: protein transport; response to retinoic acid; post-Golgi vesicle-mediated transport

Research Articles on SCAMP3

Similar Products

Product Notes

The SCAMP3 scamp3 (Catalog #AAA6144218) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCAMP3 (Secretory Carrier-associated Membrane Protein 3, Secretory Carrier Membrane Protein 3, C1orf3, PROPIN1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCAMP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCAMP3 scamp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCAMP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.