Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS2 monoclonal antibody. Western Blot analysis of RPS2 expression in human liver.)

Mouse anti-Human RPS2 Monoclonal Antibody | anti-RPS2 antibody

RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC117344, MGC117345) (HRP)

Gene Names
RPS2; S2; LLREP3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPS2; Monoclonal Antibody; RPS2 (40S Ribosomal Protein S2; 40S Ribosomal Protein S4; Protein LLRep3; RPS4; MGC102851; MGC117344; MGC117345) (HRP); anti-RPS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G6
Specificity
Recognizes human RPS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RPS2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa198-294 from human RPS2 (NP_002943) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS2 monoclonal antibody. Western Blot analysis of RPS2 expression in human liver.)

Western Blot (WB) (RPS2 monoclonal antibody. Western Blot analysis of RPS2 expression in human liver.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPS2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RPS2 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPS2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPS2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.7 kDa (316aa)
NCBI Official Full Name
40S ribosomal protein S2
NCBI Official Synonym Full Names
ribosomal protein S2
NCBI Official Symbol
RPS2
NCBI Official Synonym Symbols
S2; LLREP3
NCBI Protein Information
40S ribosomal protein S2
UniProt Protein Name
40S ribosomal protein S2
Protein Family
UniProt Gene Name
RPS2
UniProt Synonym Gene Names
RPS4

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Research Articles on RPS2

Similar Products

Product Notes

The RPS2 rps2 (Catalog #AAA6154746) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC117344, MGC117345) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS2 rps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.