Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human ITGB5 Monoclonal Antibody | anti-ITGB5 antibody

ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITGB5; Monoclonal Antibody; ITGB5 (Integrin beta-5; Integrin; beta 5; FLJ26658) (HRP); anti-ITGB5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C4
Specificity
Recognizes human ITGB5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ITGB5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa421-516 from human ITGB5 (NP_002204) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(ITGB5 monoclonal antibody Western Blot analysis of ITGB5 expression in HeLa.)

Western Blot (WB) (ITGB5 monoclonal antibody Western Blot analysis of ITGB5 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody. Lane 1: ITGB5 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody. Lane 1: ITGB5 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ITGB5 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ITGB5 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-ITGB5 antibody
Integrins are heterodimers composed of non-covalently associated transmembrane alpha and beta subunits. Most integrin receptors bind ligands, components of the extracellular matrix, including fibronectin, collagen and vitronectin. Ligands serve to cross-link or cluster integrins by binding to adjacent integrin receptors. In addition to mediating cell adhesion and cytoskeletal organization, integrins function as signaling receptors.
Product Categories/Family for anti-ITGB5 antibody
References
1. beta5 integrin is the major contributor to the Vintegrin-mediated blockade of HIV-1 replication. Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA.J Immunol. 2011 Jan 1;186(1):464-70. Epub 2010 Nov 22.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,054 Da
NCBI Official Full Name
integrin beta-5
NCBI Official Synonym Full Names
integrin, beta 5
NCBI Official Symbol
ITGB5
NCBI Protein Information
integrin beta-5
UniProt Protein Name
Integrin beta-5
Protein Family
UniProt Gene Name
ITGB5
UniProt Entry Name
ITB5_HUMAN

Uniprot Description

ITGB5: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligand. Heterodimer of an alpha and a beta subunit. Beta-5 associates with alpha-V. Interacts with MYO10. Belongs to the integrin beta chain family.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21.2

Cellular Component: focal adhesion; cell surface; leading edge; plasma membrane; phagocytic vesicle; receptor complex

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; antigen processing and presentation of peptide antigen via MHC class I; extracellular matrix organization and biogenesis; muscle contraction; transforming growth factor beta receptor signaling pathway; cell-matrix adhesion; stress fiber formation; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I

Similar Products

Product Notes

The ITGB5 itgb5 (Catalog #AAA6153136) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITGB5 itgb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITGB5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.