Mouse anti-Human ITGB5 Monoclonal Antibody | anti-ITGB5 antibody

ITGB5 (Integrin beta-5, Integrin, beta 5, FLJ26658) (FITC)

Cat. Num. AAA6147833

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ITGB5; Monoclonal Antibody; ITGB5 (Integrin beta-5; Integrin; beta 5; FLJ26658) (FITC); anti-ITGB5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C4
• Specificity: Recognizes human ITGB5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ITGB5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa421-516 from human ITGB5 (NP_002204) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(ITGB5 monoclonal antibody Western Blot analysis of ITGB5 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ITGB5 expression in transfected 293T cell line by ITGB5 monoclonal antibody. Lane 1: ITGB5 transfected lysate (88.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ITGB5 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ITGB5 over-expressed 293 cell line, cotransfected with ITGB5 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ITGB5 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-ITGB5 antibody

Integrins are heterodimers composed of non-covalently associated transmembrane alpha and beta subunits. Most integrin receptors bind ligands, components of the extracellular matrix, including fibronectin, collagen and vitronectin. Ligands serve to cross-link or cluster integrins by binding to adjacent integrin receptors. In addition to mediating cell adhesion and cytoskeletal organization, integrins function as signaling receptors.

Product Categories/Family for anti-ITGB5 antibody

Antibodies; Integrin

References

1. beta5 integrin is the major contributor to the Vintegrin-mediated blockade of HIV-1 replication. Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA.J Immunol. 2011 Jan 1;186(1):464-70. Epub 2010 Nov 22.

NCBI and Uniprot Product Information

• NCBI GI #: 20127446
• NCBI GeneID: 3693
• NCBI Accession #: NP_002204
• NCBI GenBank Nucleotide #: NM_002213
• UniProt Accession #: P18084; B0LPF8; B2RD70
• Molecular Weight: 88,054 Da
• NCBI Official Full Name: integrin beta-5
• NCBI Official Synonym Full Names: integrin, beta 5
• NCBI Official Symbol: ITGB5
• NCBI Protein Information: integrin beta-5
• UniProt Protein Name: Integrin beta-5
• Protein Family: Integrin
• UniProt Gene Name: ITGB5
• UniProt Entry Name: ITB5_HUMAN

Uniprot Description

ITGB5: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligand. Heterodimer of an alpha and a beta subunit. Beta-5 associates with alpha-V. Interacts with MYO10. Belongs to the integrin beta chain family.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21.2

Cellular Component: focal adhesion; cell surface; leading edge; plasma membrane; phagocytic vesicle; receptor complex

Molecular Function: integrin binding; protein binding; receptor activity

Biological Process: integrin-mediated signaling pathway; antigen processing and presentation of peptide antigen via MHC class I; extracellular matrix organization and biogenesis; muscle contraction; transforming growth factor beta receptor signaling pathway; cell-matrix adhesion; stress fiber formation; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I