Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human GSR Monoclonal Antibody | anti-GSR antibody

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (HRP)

Gene Names
GSR; HEL-75; HEL-S-122m
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSR; Monoclonal Antibody; GSR (Glutathione Reductase; Mitochondrial; GR; GRase; GLUR; GRD1; MGC78522) (HRP); anti-GSR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B4
Specificity
Recognizes human GSR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GSR antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.)

Western Blot (WB) (GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-GSR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,267 Da
NCBI Official Full Name
glutathione reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutathione-disulfide reductase
NCBI Official Symbol
GSR
NCBI Official Synonym Symbols
HEL-75; HEL-S-122m
NCBI Protein Information
glutathione reductase, mitochondrial
UniProt Protein Name
Glutathione reductase, mitochondrial
Protein Family
UniProt Gene Name
GSR
UniProt Synonym Gene Names
GLUR; GRD1; GR; GRase
UniProt Entry Name
GSHR_HUMAN

NCBI Description

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Aug 2010]

Uniprot Description

GSR: a class-I pyridine nucleotide-disulfide oxidoreductase. Maintains high levels of reduced glutathione in the cytosol. Alternative initiation results in a mitochondrial and a cytoplasmic isoform.

Protein type: EC 1.8.1.7; Other Amino Acids Metabolism - glutathione; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p21.1

Cellular Component: mitochondrial matrix; cytosol; external side of plasma membrane

Molecular Function: mercury (II) reductase activity; FAD binding; electron carrier activity; mercury ion binding; NADP binding; glutathione-disulfide reductase activity

Biological Process: response to reactive oxygen species; glutathione metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; cell redox homeostasis; detoxification of mercury ion

Research Articles on GSR

Similar Products

Product Notes

The GSR gsr (Catalog #AAA6152788) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSR gsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.