Mouse anti-Human GSR Monoclonal Antibody | anti-GSR antibody

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)

Cat. Num. AAA6142182

• Gene Names: GSR; HEL-75; HEL-S-122m
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSR; Monoclonal Antibody; GSR (Glutathione Reductase; Mitochondrial; GR; GRase; GLUR; GRD1; MGC78522) (Biotin); anti-GSR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6B4
• Specificity: Recognizes human GSR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GSR antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 6ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa413-522 from human GSR (NP_000628) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(GSR monoclonal antibody Western Blot analysis of GSR expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of GSR expression in transfected 293T cell line by GSR monoclonal antibody. Lane 1: GSR transfected lysate (56.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSR on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSR is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of GSR over-expressed 293 cell line, cotransfected with GSR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSR monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-GSR antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 50301238
• NCBI GeneID: 2936
• NCBI Accession #: NP_000628
• NCBI GenBank Nucleotide #: NM_000637
• UniProt Accession #: P00390; Q7Z5C9; Q9NP63; C8KIL8; C8KIL9; C8KIM0; D3DSV3
• Molecular Weight: 47,267 Da
• NCBI Official Full Name: glutathione reductase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: glutathione-disulfide reductase
• NCBI Official Symbol: GSR
• NCBI Official Synonym Symbols: HEL-75; HEL-S-122m
• NCBI Protein Information: glutathione reductase, mitochondrial
• UniProt Protein Name: Glutathione reductase, mitochondrial
• Protein Family: Glutathione reductase
• UniProt Gene Name: GSR
• UniProt Synonym Gene Names: GLUR; GRD1; GR; GRase
• UniProt Entry Name: GSHR_HUMAN

NCBI Description

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Aug 2010]

Uniprot Description

GSR: a class-I pyridine nucleotide-disulfide oxidoreductase. Maintains high levels of reduced glutathione in the cytosol. Alternative initiation results in a mitochondrial and a cytoplasmic isoform.

Protein type: EC 1.8.1.7; Other Amino Acids Metabolism - glutathione; Oxidoreductase

Chromosomal Location of Human Ortholog: 8p21.1

Cellular Component: mitochondrial matrix; cytosol; external side of plasma membrane

Molecular Function: mercury (II) reductase activity; FAD binding; electron carrier activity; mercury ion binding; NADP binding; glutathione-disulfide reductase activity

Biological Process: response to reactive oxygen species; glutathione metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; cell redox homeostasis; detoxification of mercury ion