Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (55.37kD).)

Mouse anti-Human Connexin 30.3 Monoclonal Antibody | anti-Cx30.3 antibody

Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4) (HRP)

Gene Names
GJB4; EKV; CX30.3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Connexin 30.3; Monoclonal Antibody; Connexin 30.3 (Gap Junction beta-4 Protein; Connexin-30.3; Cx30.3; GJB4) (HRP); anti-Cx30.3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E3-1C12
Specificity
Recognizes human GJB4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-Cx30.3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-267 from human GJB4 (AAH34709) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (55.37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (55.37kD).)

Western Blot (WB)

(GJB4 monoclonal antibody, Western Blot analysis of GJB4 expression in Hela.)

Western Blot (WB) (GJB4 monoclonal antibody, Western Blot analysis of GJB4 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 monoclonal antibody. Lane 1: GJB4 transfected lysate (30kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 monoclonal antibody. Lane 1: GJB4 transfected lysate (30kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GJB4 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GJB4 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-Cx30.3 antibody
Gap junctions permit direct cell-to-cell passage of small cytoplasmic molecules, including ions, metabolic intermediates, and second messengers, and thereby mediate intercellular communication. Gap junction channels consist of connexin protein subunits encoded by a multigene family. Erythrokeratodermia variabilis (EKV) is an autosomal dominant disorder of keratinization characterized by migratory erythematous lesions and fixed keratotic plaques. Mutations in the GJB3 gene have been reported in some but not all families, although it has been postulated that the absence of connexin 30.3 can be compensated by other connexins.
Product Categories/Family for anti-Cx30.3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,419 Da
NCBI Official Full Name
Homo sapiens gap junction protein, beta 4, 30.3kDa, mRNA
NCBI Official Synonym Full Names
gap junction protein beta 4
NCBI Official Symbol
GJB4
NCBI Official Synonym Symbols
EKV; CX30.3
NCBI Protein Information
gap junction beta-4 protein

NCBI Description

This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]

Research Articles on Cx30.3

Similar Products

Product Notes

The Cx30.3 (Catalog #AAA6151913) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Connexin 30.3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the Cx30.3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Connexin 30.3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.