Mouse anti-Human Connexin 30.3 Monoclonal Antibody | anti-Cx30.3 antibody

Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4) (AP)

Cat. Num. AAA6130701

• Gene Names: GJB4; EKV; CX30.3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Connexin 30.3; Monoclonal Antibody; Connexin 30.3 (Gap Junction beta-4 Protein; Connexin-30.3; Cx30.3; GJB4) (AP); anti-Cx30.3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E3-1C12
• Specificity: Recognizes human GJB4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-Cx30.3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-267 from human GJB4 (AAH34709) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (55.37kD).)

Western Blot (WB)

(GJB4 monoclonal antibody, Western Blot analysis of GJB4 expression in Hela.)

Western Blot (WB)

(Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 monoclonal antibody. Lane 1: GJB4 transfected lysate (30kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GJB4 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-Cx30.3 antibody

Gap junctions permit direct cell-to-cell passage of small cytoplasmic molecules, including ions, metabolic intermediates, and second messengers, and thereby mediate intercellular communication. Gap junction channels consist of connexin protein subunits encoded by a multigene family. Erythrokeratodermia variabilis (EKV) is an autosomal dominant disorder of keratinization characterized by migratory erythematous lesions and fixed keratotic plaques. Mutations in the GJB3 gene have been reported in some but not all families, although it has been postulated that the absence of connexin 30.3 can be compensated by other connexins.

Product Categories/Family for anti-Cx30.3 antibody

Antibodies; Connexin; Junction Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21961203
• NCBI GeneID: 127534
• Molecular Weight: 30,419 Da
• NCBI Official Full Name: Homo sapiens gap junction protein, beta 4, 30.3kDa, mRNA
• NCBI Official Synonym Full Names: gap junction protein beta 4
• NCBI Official Symbol: GJB4
• NCBI Official Synonym Symbols: EKV; CX30.3
• NCBI Protein Information: gap junction beta-4 protein

NCBI Description

This gene encodes a transmembrane connexin protein that is a component of gap junctions. Mutations in this gene have been associated with erythrokeratodermia variabilis, progressive symmetric erythrokeratoderma and hearing impairment. [provided by RefSeq, Dec 2009]