Mouse anti-Human Antithrombin-III Monoclonal Antibody | anti-ATIII antibody

Antithrombin-III (SERPINC1, ATIII, Serpin C1, AT3, PRO0309) (HRP)

Cat. Num. AAA6151214

• Gene Names: SERPINC1; AT3; AT3D; ATIII; THPH7
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Antithrombin-III; Monoclonal Antibody; Antithrombin-III (SERPINC1; ATIII; Serpin C1; AT3; PRO0309) (HRP); anti-ATIII antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B12
• Specificity: Recognizes human Antithrombin-III.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Concentration: 1 mg/mL (varies by lot)
• Sequence: MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAEPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWELSKANSRF; ATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFG; DKSLTFNDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK

• Applicable Applications for anti-ATIII antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-259 from human Antithrombin-III with GST tag. MW of the GST tag alone is 26kD.
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using MBS6151214 (54.23kD).)

Western Blot (WB)

(Western Blot analysis of MBS6151214 expressed in human kidney.)

Western Blot (WB)

(Western Blot analysis of MBS6151214 expression in transfected 293T cell line by MBS6151214 Lane 1: SERPINC1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ATIII antibody

Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.

Product Categories/Family for anti-ATIII antibody

Antibodies; Coagulation Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18490838
• NCBI GeneID: 462
• NCBI Official Full Name: Homo sapiens serpin peptidase inhibitor, clade C (antithrombin), member 1, mRNA
• NCBI Official Synonym Full Names: serpin family C member 1
• NCBI Official Symbol: SERPINC1
• NCBI Official Synonym Symbols: AT3; AT3D; ATIII; THPH7
• NCBI Protein Information: antithrombin-III
• Protein Family: Antithrombin

NCBI Description

The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade. The protein includes two functional domains: the heparin binding-domain at the N-terminus of the mature protein, and the reactive site domain at the C-terminus. The inhibitory activity is enhanced by the presence of heparin. More than 120 mutations have been identified for this gene, many of which are known to cause antithrombin-III deficiency. [provided by RefSeq, Jul 2009]