Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ACSS2 Monoclonal Antibody | anti-ACSS2 antibody

ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (HRP)

Gene Names
ACSS2; ACS; ACSA; ACAS2; ACECS; dJ1161H23.1; DKFZp762G026
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACSS2; Monoclonal Antibody; ACSS2 (ACAS2; Acetyl-coenzyme A Synthetase; Cytoplasmic; Acetate-CoA Ligase; Acetyl-CoA Synthetase; Acyl-CoA Synthetase Short-chain Family Member 2; Acyl-activating Enzyme; DKFZp762G026; DJ1161H23.1) (HRP); anti-ACSS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A10
Specificity
Recognizes human ACSS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ACSS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa32-131 from human ACSS2 (NP_061147) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged ACSS2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ACSS2 is 1ng/ml as a capture antibody.)
Related Product Information for anti-ACSS2 antibody
This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq].
Product Categories/Family for anti-ACSS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
78,580 Da
NCBI Official Full Name
acetyl-coenzyme A synthetase, cytoplasmic isoform 1
NCBI Official Synonym Full Names
acyl-CoA synthetase short-chain family member 2
NCBI Official Symbol
ACSS2
NCBI Official Synonym Symbols
ACS; ACSA; ACAS2; ACECS; dJ1161H23.1; DKFZp762G026
NCBI Protein Information
acetyl-coenzyme A synthetase, cytoplasmic; OTTHUMP00000030713; OTTHUMP00000030717; acetate thiokinase; acetate-CoA ligase; acyl-activating enzyme; cytoplasmic acetyl-coenzyme A synthetase; acetyl-Coenzyme A synthetase 2 (ADP forming)
UniProt Protein Name
Acetyl-coenzyme A synthetase, cytoplasmic
UniProt Gene Name
ACSS2
UniProt Synonym Gene Names
ACAS2; ACS; AceCS
UniProt Entry Name
ACSA_HUMAN

NCBI Description

This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Uniprot Description

ACSS2: Activates acetate so that it can be used for lipid synthesis or for energy generation. Monomer. Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: Carbohydrate Metabolism - propanoate; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Ligase; EC 6.2.1.1; Carbohydrate Metabolism - pyruvate

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; cytosol

Molecular Function: acetate-CoA ligase activity; ATP binding; AMP binding

Biological Process: acetyl-CoA biosynthetic process from acetate; xenobiotic metabolic process; lipid biosynthetic process; ethanol oxidation; propionate biosynthetic process; acetate biosynthetic process

Research Articles on ACSS2

Similar Products

Product Notes

The ACSS2 acss2 (Catalog #AAA6151062) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACSS2 (ACAS2, Acetyl-coenzyme A Synthetase, Cytoplasmic, Acetate-CoA Ligase, Acetyl-CoA Synthetase, Acyl-CoA Synthetase Short-chain Family Member 2, Acyl-activating Enzyme, DKFZp762G026, DJ1161H23.1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACSS2 acss2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACSS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.