Mouse anti-Human TRIM24 Monoclonal Antibody | anti-TRIM24 antibody

TRIM24 (Transcription Intermediary Factor 1-alpha, TIF1-alpha, E3 Ubiquitin-protein Ligase TRIM24, RING Finger Protein 82, Tripartite Motif-containing Protein 24, RNF82, TIF1, TIF1A) (FITC)

Cat. Num. AAA6150224

• Gene Names: TRIM24; PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TRIM24; Monoclonal Antibody; TRIM24 (Transcription Intermediary Factor 1-alpha; TIF1-alpha; E3 Ubiquitin-protein Ligase TRIM24; RING Finger Protein 82; Tripartite Motif-containing Protein 24; RNF82; TIF1; TIF1A) (FITC); anti-TRIM24 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 2F2
• Specificity: Recognizes human TRIM24.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TRIM24 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa432-569 from TRIM24 (AAH28689) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in IMR-32.)

Western Blot (WB)

(TRIM24 monoclonal antibody Western Blot analysis of TRIM24 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TRIM24 expression in transfected 293T cell line by TRIM24 monoclonal antibody Lane 1: TRIM24 transfected lysate (116.8kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. [antibody concentration 6ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIM24 on HeLa cell. [antibody concentration 10ug/ml.)

Immunoprecipitation (IP)

(Immunoprecipitation of TRIM24 transfected lysate using TRIM24 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TRIM24 rabbit polyclonal antibody.)

Product Categories/Family for anti-TRIM24 antibody

Antibodies; Transcription Factors

References

1. TRIM24 mediates ligand-dependent activation of androgen receptor and is repressed by a bromodomain-containing protein, BRD7, in prostate cancer cells. Kikuchi M, Okumura F, Tsukiyama T, Watanabe M, Miyajima N, Tanaka J, Imamura M, Hatakeyama S.Biochim Biophys Acta. 2009 Dec;1793(12):1828-36. Epub 2009 Nov 10.

NCBI and Uniprot Product Information

• NCBI GI #: 21040396
• NCBI GeneID: 8805
• UniProt Accession #: O15164; O95854; A4D1R7; A4D1R8
• Molecular Weight: Calculated Molecular Weight: 117kDa; Observed Molecular Weight: 116kDa
• NCBI Official Full Name: Homo sapiens tripartite motif-containing 24, mRNA
• NCBI Official Synonym Full Names: tripartite motif containing 24
• NCBI Official Symbol: TRIM24
• NCBI Official Synonym Symbols: PTC6; TF1A; TIF1; RNF82; TIF1A; hTIF1; TIF1ALPHA
• NCBI Protein Information: transcription intermediary factor 1-alpha
• UniProt Protein Name: Transcription intermediary factor 1-alpha
• Protein Family: Transcription intermediary factor
• UniProt Gene Name: TRIM24
• UniProt Synonym Gene Names: RNF82; TIF1; TIF1A; TIF1-alpha
• UniProt Entry Name: TIF1A_HUMAN

NCBI Description

The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM24: an atypical protein kinase that functions as a transcriptional coactivator. Originally identified as a mammalian protein that enhances the AF-2 activity of the retinoid X receptor (RXR) in a yeast genetic screen. Binds to nuclear receptors in an agonist and AF2-activating domain (AF2-AD) dependent manner. Binding to the agonist-nuclear receptor complex induces its own hyperphosphorylation as well as the phosphorylation of TFIIEa, TAFII28, and TAFII55. Belongs to a family of nuclear proteins that includes TIF1b and TIF1g. TIF1 proteins are characterized by an N-terminal region that contains a RING finger-B boxes-coiled coil (RBCC) motif, a poorly conserved central region, a C-terminal region that contains a PHD finger, and a bromodomain. Interacts with the heterochromatin-associated proteins HP1a, MOD1 (HP1b), and MOD2 (HP1g) and with the transcriptional repression domain KRAB, which is present in many Kruppel-type (C2H2) zinc finger proteins. May act as a repressor through the formation of transcriptionally inactive heterochromatin. Two splice variant isoforms have been described.

Protein type: Tumor suppressor; EC 6.3.2.-; Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Protein kinase, atypical; Kinase, protein; Ubiquitin conjugating system; ATYPICAL group; TIF1 family

Chromosomal Location of Human Ortholog: 7q32-q34

Cellular Component: nucleoplasm; perichromatin fibrils; cytosol; nucleus

Molecular Function: ligand-dependent nuclear receptor binding; protein binding; zinc ion binding; p53 binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; estrogen response element binding; chromatin binding; methylated histone residue binding; receptor binding; ligase activity; protein kinase activity

Biological Process: calcium ion homeostasis; transcription from RNA polymerase II promoter; regulation of apoptosis; negative regulation of cell proliferation; response to peptide hormone stimulus; positive regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; regulation of protein stability; protein ubiquitination; protein catabolic process; negative regulation of transcription, DNA-dependent

Disease: Thyroid Carcinoma, Papillary