Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (30.84kD).)

Mouse anti-Human SLC11A1 Monoclonal Antibody | anti-SLC11A1 antibody

SLC11A1 (Natural Resistance-associated Macrophage Protein 1, NRAMP 1, LSH, NRAMP, NRAMP1) (FITC)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC11A1; Monoclonal Antibody; SLC11A1 (Natural Resistance-associated Macrophage Protein 1; NRAMP 1; LSH; NRAMP; NRAMP1) (FITC); anti-SLC11A1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G2
Specificity
Recognizes human SLC11A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
550
Applicable Applications for anti-SLC11A1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa308-350 from human SLC11A1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (30.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (30.84kD).)

Western Blot (WB)

(Western Blot analysis of MBS6004701 expression in human liver.)

Western Blot (WB) (Western Blot analysis of MBS6004701 expression in human liver.)

Testing Data

(Detection limit for recombinant GST tagged SLC11A1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC11A1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-SLC11A1 antibody
NRAMP1, also known as SLC11A1, is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as leprosy and tuberculosis, and inflammatory diseases such as Crohn disease and rheumatoid arthritis. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
Product Categories/Family for anti-SLC11A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1 isoform a

Similar Products

Product Notes

The SLC11A1 (Catalog #AAA6149684) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC11A1 (Natural Resistance-associated Macrophage Protein 1, NRAMP 1, LSH, NRAMP, NRAMP1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC11A1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC11A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC11A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.