Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.82kD).)

Mouse anti-Human, Rat SH3GL2 Monoclonal Antibody | anti-SH3GL2 antibody

SH3GL2 (Endophilin-A1, EEN-B1, Endophilin-1, SH3 Domain Protein 2A, SH3 Domain-containing GRB2-like Protein 2, CNSA2, SH3D2A, FLJ20276, FLJ25015) (FITC)

Gene Names
SH3GL2; CNSA2; SH3P4; EEN-B1; SH3D2A
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH3GL2; Monoclonal Antibody; SH3GL2 (Endophilin-A1; EEN-B1; Endophilin-1; SH3 Domain Protein 2A; SH3 Domain-containing GRB2-like Protein 2; CNSA2; SH3D2A; FLJ20276; FLJ25015) (FITC); anti-SH3GL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A6
Specificity
Recognizes human SH3GL2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SH3GL2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa64-124 from human SH3GL2 (NM_003026, NP_003017) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.82kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.82kD).)

Western Blot (WB)

(Western Blot analysis of SH3GL2 expression in PC-12 using 133306.)

Western Blot (WB) (Western Blot analysis of SH3GL2 expression in PC-12 using 133306.)

Immunohistochemistry (IHC)

(Immunoperoxidase in formalin-fixed paraffin-embedded human cerebral cortex using 133306 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase in formalin-fixed paraffin-embedded human cerebral cortex using 133306 (3ug/ml).)

Testing Data

(Detection limit for recombinant GST tagged SH3GL2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SH3GL2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SH3GL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42.5 kDa (376aa) confirmed by MALDI-TOF
NCBI Official Full Name
endophilin-A1
NCBI Official Synonym Full Names
SH3 domain containing GRB2 like 2, endophilin A1
NCBI Official Symbol
SH3GL2
NCBI Official Synonym Symbols
CNSA2; SH3P4; EEN-B1; SH3D2A
NCBI Protein Information
endophilin-A1
UniProt Protein Name
Endophilin-A1
Protein Family
UniProt Gene Name
SH3GL2
UniProt Synonym Gene Names
CNSA2; SH3D2A
UniProt Entry Name
SH3G2_HUMAN

Uniprot Description

endophilin 1: Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature. Belongs to the endophilin family.

Protein type: Membrane protein, peripheral; Vesicle; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: Golgi membrane; plasma membrane; cytosol

Molecular Function: identical protein binding; protein binding; lipid binding

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of epidermal growth factor receptor signaling pathway; axon guidance; central nervous system development; nerve growth factor receptor signaling pathway; regulation of receptor internalization; synaptic vesicle endocytosis; antigen processing and presentation of exogenous peptide antigen via MHC class II; post-Golgi vesicle-mediated transport; signal transduction

Research Articles on SH3GL2

Similar Products

Product Notes

The SH3GL2 sh3gl2 (Catalog #AAA6149643) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH3GL2 (Endophilin-A1, EEN-B1, Endophilin-1, SH3 Domain Protein 2A, SH3 Domain-containing GRB2-like Protein 2, CNSA2, SH3D2A, FLJ20276, FLJ25015) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SH3GL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH3GL2 sh3gl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH3GL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.