Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TPBG monoclonal antibody. Western Blot analysis of TPBG expression in HeLa.)

Mouse anti-Human, Rat Oncofetal Antigen 5T4 Monoclonal Antibody | anti-TPBG antibody

Oncofetal Antigen 5T4 (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (FITC)

Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Oncofetal Antigen 5T4; Monoclonal Antibody; Oncofetal Antigen 5T4 (TPBG; Trophoblast Glycoprotein; 5T4 Oncofetal antigen; 5T4 Oncofetal Trophoblast Glycoprotein; M6P1) (FITC); anti-TPBG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B6
Specificity
Recognizes human TPBG. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
420
Applicable Applications for anti-TPBG antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa219-328 from human TPBG (NP_006661) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TPBG monoclonal antibody. Western Blot analysis of TPBG expression in HeLa.)

Western Blot (WB) (TPBG monoclonal antibody. Western Blot analysis of TPBG expression in HeLa.)

Western Blot (WB)

(TPBG monoclonal antibody. Western Blot analysis of TPBG expression in PC-12.)

Western Blot (WB) (TPBG monoclonal antibody. Western Blot analysis of TPBG expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged TPBG is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TPBG is ~1ng/ml as a capture antibody.)
Related Product Information for anti-TPBG antibody
Oncofetal antigen 5T4, also TPBG and trophoblast glycoprotein, is a 72kD glycoprotein member of the LRR family of proteins. It is expressed on trophoblasts, tumor cells, ovarian cuboidal epithelium and embryonic stem cells, and impacts cell adhesion and motility. The human 5T4 cDNA encodes a type I transmembrane protein precursor that is 420aa in length. It contains a 324aa extracellular region (aa32-355) that shows one Ser-rich region followed by seven Leu-rich repeats (aa90-355). Over aa31-355, human 5T4 shares 81% and 85% aa identity with mouse and canine 5T4, respectively.
Product Categories/Family for anti-TPBG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
trophoblast glycoprotein
UniProt Protein Name
Trophoblast glycoprotein
Protein Family
UniProt Gene Name
TPBG
UniProt Synonym Gene Names
5T4; 5T4 oncotrophoblast glycoprotein
UniProt Entry Name
TPBG_HUMAN

Uniprot Description

Subcellular location: Membrane; Single-pass type I membrane protein

Potential.

Tissue specificity: Expressed by all types of trophoblasts as early as 9 weeks of development. Specific for trophoblastic cells except for amniotic epithelium. In adult tissues, the expression is limited to a few epithelial cell types but is found on a variety of carcinoma.

Miscellaneous: Antigen 5T4 is overexpressed by a wide spectrum of cancers, including colorectal, ovarian and gastric, but with a limited normal tissue expression. Could be used for tumor immunotherapy.

Sequence similarities: Contains 6 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.Contains 1 LRRNT domain.

Similar Products

Product Notes

The Oncofetal Antigen 5T4 tpbg (Catalog #AAA6148618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Oncofetal Antigen 5T4 (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Oncofetal Antigen 5T4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the Oncofetal Antigen 5T4 tpbg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Oncofetal Antigen 5T4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.