Mouse anti-Human MAPK10 Monoclonal Antibody | anti-MAPK10 antibody

MAPK10 (Mitogen-activated Protein Kinase 10, MAPK 10, MAP Kinase 10, PRKM10, c-Jun N-terminal Kinase 3, JNK3, JNK3A, MAP Kinase p49 3F12, p493F12, p54bSAPK, Stress-activated Protein Kinase 1b, SAPK1b, Stress-activated Protein Kinase JNK3, FLJ12099, FLJ337

Cat. Num. AAA6148116

• Gene Names: MAPK10; JNK3; JNK3A; PRKM10; SAPK1b; p493F12; p54bSAPK
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MAPK10; Monoclonal Antibody; MAPK10 (Mitogen-activated Protein Kinase 10; MAPK 10; MAP Kinase 10; PRKM10; c-Jun N-terminal Kinase 3; JNK3; JNK3A; MAP Kinase p49 3F12; p493F12; p54bSAPK; Stress-activated Protein Kinase 1b; SAPK1b; Stress-activated Protein Kinase JNK3; FLJ12099; FLJ337; anti-MAPK10 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B9
• Specificity: Recognizes human MAPK10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-MAPK10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa219-319, from human MAPK10, from with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MAPK10 monoclonal antibody Western Blot analysis of MAPK10 expression in HeLa.)

Related Product Information for anti-MAPK10 antibody

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This protein is a neuronal-specific form of c-Jun N-terminal kinases (JNKs). Through its phosphorylation and nuclear localization, this kinase plays regulatory roles in the signaling pathways during neuronal apoptosis. Beta-arrestin 2, a receptor-regulated MAP kinase scaffold protein, is found to interact with, and stimulate the phosphorylation of this kinase by MAP kinase kinase 4 (MKK4). Cyclin-dependent kianse 5 can phosphorylate, and inhibit the activity of this kinase, which may be important in preventing neuronal apoptosis. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Categories/Family for anti-MAPK10 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 41350833
• NCBI GeneID: 5602
• Molecular Weight: 31,933 Da
• NCBI Official Full Name: Homo sapiens mitogen-activated protein kinase 10, mRNA
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 10
• NCBI Official Symbol: MAPK10
• NCBI Official Synonym Symbols: JNK3; JNK3A; PRKM10; SAPK1b; p493F12; p54bSAPK
• NCBI Protein Information: mitogen-activated protein kinase 10

NCBI Description

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals and are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Dec 2015]