Mouse anti-Human LUC7L Monoclonal Antibody | anti-LUC7L antibody

LUC7L (LUC7L1, Putative RNA-binding Protein Luc7-like 1, Putative SR Protein LUC7B1, SR+89, FLJ10231) (FITC)

Cat. Num. AAA6148068

• Gene Names: LUC7L; Luc7; SR+89; LUC7B1; hLuc7B1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LUC7L; Monoclonal Antibody; LUC7L (LUC7L1; Putative RNA-binding Protein Luc7-like 1; Putative SR Protein LUC7B1; SR+89; FLJ10231) (FITC); anti-LUC7L antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D10
• Specificity: Recognizes human LUC7L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-LUC7L antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-111 from human LUC7L (NP_060502) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(LUC7L monoclonal antibody, Western Blot analysis of LUC7L expression in IMR-32.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-LUC7L antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 8922297
• NCBI GeneID: 55692
• NCBI Accession #: NP_060502
• NCBI GenBank Nucleotide #: NM_018032
• UniProt Accession #: Q1W6G4; Q9NQ29
• Molecular Weight: 36kDa
• NCBI Official Full Name: putative RNA-binding protein Luc7-like 1 isoform a
• NCBI Official Synonym Full Names: LUC7 like
• NCBI Official Symbol: LUC7L
• NCBI Official Synonym Symbols: Luc7; SR+89; LUC7B1; hLuc7B1
• NCBI Protein Information: putative RNA-binding protein Luc7-like 1
• UniProt Protein Name: LUC7-like (S. cerevisiae)
• Protein Family: Putative RNA-binding protein
• UniProt Gene Name: LUC7L
• UniProt Entry Name: Q1W6G4_HUMAN

NCBI Description

The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]

Uniprot Description

LUC7L iso2: May bind to RNA via its Arg/Ser-rich domain. Belongs to the Luc7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: snRNP U1

Molecular Function: mRNA binding; identical protein binding; protein binding; RS domain binding

Biological Process: mRNA splice site selection; negative regulation of striated muscle development