Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human LUC7L Monoclonal Antibody | anti-LUC7L antibody

LUC7L (LUC7L1, Putative RNA-binding Protein Luc7-like 1, Putative SR Protein LUC7B1, SR+89, FLJ10231)

Gene Names
LUC7L; Luc7; SR+89; LUC7B1; hLuc7B1; LUC7-LIKE
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LUC7L; Monoclonal Antibody; LUC7L (LUC7L1; Putative RNA-binding Protein Luc7-like 1; Putative SR Protein LUC7B1; SR+89; FLJ10231); Anti -LUC7L (LUC7L1; anti-LUC7L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D10
Specificity
Recognizes human LUC7L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAE
Applicable Applications for anti-LUC7L antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-111 from human LUC7L (NP_060502) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(LUC7L monoclonal antibody, Western Blot analysis of LUC7L expression in IMR-32.)

Western Blot (WB) (LUC7L monoclonal antibody, Western Blot analysis of LUC7L expression in IMR-32.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LUC7L on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-LUC7L antibody
May bind to RNA via its Arg/Ser-rich domain.
Product Categories/Family for anti-LUC7L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43,728 Da
NCBI Official Full Name
LUC7L protein
NCBI Official Synonym Full Names
LUC7-like (S. cerevisiae)
NCBI Official Symbol
LUC7L
NCBI Official Synonym Symbols
Luc7; SR+89; LUC7B1; hLuc7B1; LUC7-LIKE
NCBI Protein Information
putative RNA-binding protein Luc7-like 1; putative SR protein LUC7B1; sarcoplasmic reticulum protein LUC7B1
UniProt Protein Name
Putative RNA-binding protein Luc7-like 1
UniProt Gene Name
LUC7L
UniProt Synonym Gene Names
LUC7L1
UniProt Entry Name
LUC7L_HUMAN

NCBI Description

The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]

Uniprot Description

LUC7L: May bind to RNA via its Arg/Ser-rich domain. Belongs to the Luc7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: snRNP U1

Molecular Function: mRNA binding; identical protein binding; protein binding; RS domain binding

Biological Process: mRNA splice site selection; negative regulation of striated muscle development

Research Articles on LUC7L

Similar Products

Product Notes

The LUC7L luc7l (Catalog #AAA6008712) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LUC7L (LUC7L1, Putative RNA-binding Protein Luc7-like 1, Putative SR Protein LUC7B1, SR+89, FLJ10231) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LUC7L can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the LUC7L luc7l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAQAQMRAL LDQLMGTARD GDETRQRVKF TDDRVCKSHL LDCCPHDILA GTRMDLGECT KIHDLALRAD YEIASKERDL FFELDAMDHL ESFIAECDRR TELAKKRLAE. It is sometimes possible for the material contained within the vial of "LUC7L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.