Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of GPX5 transfected lysate using GPX5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GPX5 rabbit polyclonal antibody.)

Mouse anti-Human GPX5 Monoclonal Antibody | anti-GPX5 antibody

GPX5 (Epididymal Secretory Glutathione Peroxidase, Epididymis-specific Glutathione Peroxidase-like Protein, EGLP, Glutathione Peroxidase 5, GPx-5, GSHPx-5) (FITC)

Gene Names
GPX5; EGLP; GPx-5; GSHPx-5; HEL-S-75p
Reactivity
Human
Applications
ELISA, Immunoprecipitation
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GPX5; Monoclonal Antibody; GPX5 (Epididymal Secretory Glutathione Peroxidase; Epididymis-specific Glutathione Peroxidase-like Protein; EGLP; Glutathione Peroxidase 5; GPx-5; GSHPx-5) (FITC); anti-GPX5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B9
Specificity
Recognizes human GPX5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
221
Applicable Applications for anti-GPX5 antibody
ELISA (EIA), Immunoprecipitation (IP)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa122-221 from human GPX5 (NP_001500) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISWDPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of GPX5 transfected lysate using GPX5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GPX5 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GPX5 transfected lysate using GPX5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GPX5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GPX5 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPX5 is 1ng/ml as a capture antibody.)
Related Product Information for anti-GPX5 antibody
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Product Categories/Family for anti-GPX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
epididymal secretory glutathione peroxidase isoform 1
NCBI Official Synonym Full Names
glutathione peroxidase 5
NCBI Official Symbol
GPX5
NCBI Official Synonym Symbols
EGLP; GPx-5; GSHPx-5; HEL-S-75p
NCBI Protein Information
epididymal secretory glutathione peroxidase
UniProt Protein Name
Epididymal secretory glutathione peroxidase
UniProt Gene Name
GPX5
UniProt Synonym Gene Names
EGLP; GPx-5; GSHPx-5
UniProt Entry Name
GPX5_HUMAN

NCBI Description

This gene belongs to the glutathione peroxidase family. It is specifically expressed in the epididymis in the mammalian male reproductive tract, and is androgen-regulated. Unlike several other characterized glutathione peroxidases, this enzyme is not a selenoprotein, lacking the selenocysteine residue. Thus, it is selenium-independent, and has been proposed to play a role in protecting the membranes of spermatozoa from the damaging effects of lipid peroxidation and/or preventing premature acrosome reaction. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2016]

Uniprot Description

GPX5: Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Belongs to the glutathione peroxidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.11.1.9; Secreted, signal peptide; Other Amino Acids Metabolism - glutathione; Oxidoreductase; Lipid Metabolism - arachidonic acid; Secreted

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: extracellular space

Molecular Function: glutathione peroxidase activity

Biological Process: response to oxidative stress; lipid metabolic process

Research Articles on GPX5

Similar Products

Product Notes

The GPX5 gpx5 (Catalog #AAA6147454) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GPX5 (Epididymal Secretory Glutathione Peroxidase, Epididymis-specific Glutathione Peroxidase-like Protein, EGLP, Glutathione Peroxidase 5, GPx-5, GSHPx-5) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPX5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPX5 gpx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.