Mouse anti-Human ERBB3 Monoclonal Antibody | anti-ERBB3 antibody

ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) (FITC)

Cat. Num. AAA6147069

• Gene Names: ERBB3; HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ERBB3; Monoclonal Antibody; ERBB3 (Receptor Tyrosine-protein Kinase erbB-3; Proto-oncogene-like Protein c-ErbB-3; Tyrosine Kinase-type Cell Surface Receptor HER3; HER3) (FITC); anti-ERBB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E9
• Specificity: Recognizes human ERBB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ERBB3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-130 from human ERBB3 (AAH02706) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.04kD).)

Western Blot (WB)

(ERBB3 monoclonal antibody, Western Blot analysis of ERBB3 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 2ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ERBB3 is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-ERBB3 antibody

Antibodies; Oncoproteins

NCBI and Uniprot Product Information

• NCBI GI #: 33877047
• NCBI GeneID: 2065
• Molecular Weight: 77,426 Da
• NCBI Official Full Name: Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian), mRNA
• NCBI Official Synonym Full Names: erb-b2 receptor tyrosine kinase 3
• NCBI Official Symbol: ERBB3
• NCBI Official Synonym Symbols: HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
• NCBI Protein Information: receptor tyrosine-protein kinase erbB-3
• Protein Family: Receptor tyrosine-protein kinase

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]