Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (40.04kD).)

Mouse anti-Human ERBB3 Monoclonal Antibody | anti-ERBB3 antibody

ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) APC

Gene Names
ERBB3; HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ERBB3; Monoclonal Antibody; ERBB3 (Receptor Tyrosine-protein Kinase erbB-3; Proto-oncogene-like Protein c-ErbB-3; Tyrosine Kinase-type Cell Surface Receptor HER3; HER3) APC; anti-ERBB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E9
Specificity
Recognizes human ERBB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ERBB3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-130 from human ERBB3 (AAH02706) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.04kD).)

Western Blot (WB) (Western Blot detection against Immunogen (40.04kD).)

Western Blot (WB)

(ERBB3 monoclonal antibody, Western Blot analysis of ERBB3 expression in Hela NE.)

Western Blot (WB) (ERBB3 monoclonal antibody, Western Blot analysis of ERBB3 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 2ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 2ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ERBB3 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ERBB3 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-ERBB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
77,426 Da
NCBI Official Full Name
Homo sapiens v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian), mRNA
NCBI Official Synonym Full Names
erb-b2 receptor tyrosine kinase 3
NCBI Official Symbol
ERBB3
NCBI Official Synonym Symbols
HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
NCBI Protein Information
receptor tyrosine-protein kinase erbB-3

NCBI Description

This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008]

Research Articles on ERBB3

Similar Products

Product Notes

The ERBB3 (Catalog #AAA6136463) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ERBB3 (Receptor Tyrosine-protein Kinase erbB-3, Proto-oncogene-like Protein c-ErbB-3, Tyrosine Kinase-type Cell Surface Receptor HER3, HER3) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ERBB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERBB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERBB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.