Mouse anti-Human DUSP1 Monoclonal Antibody | anti-DUSP1 antibody

DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) (FITC)

Cat. Num. AAA6146925

• Gene Names: DUSP1; HVH1; MKP1; CL100; MKP-1; PTPN10
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DUSP1; Monoclonal Antibody; DUSP1 (Dual Specificity Protein Phosphatase 1; CL100; Dual Specificity Protein Phosphatase hVH1; HVH1; Mitogen-activated Protein Kinase Phosphatase 1; MAP Kinase Phosphatase 1; MKP1; MKP-1; Protein-tyrosine Phosphatase CL100; PTPN10; VH1) (FITC); anti-DUSP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H7
• Specificity: Recognizes human DUSP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 367

• Applicable Applications for anti-DUSP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa305-367 from human DUSP1 (NP_004408) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.67kD).)

Testing Data

(Detection limit for recombinant GST tagged DUSP1 is 0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DUSP1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DUSP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-DUSP1 antibody

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.

Product Categories/Family for anti-DUSP1 antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 4758204
• NCBI GeneID: 1843
• NCBI Accession #: NP_004408
• NCBI GenBank Nucleotide #: NM_004417
• UniProt Accession #: P28562
• NCBI Official Full Name: dual specificity protein phosphatase 1
• NCBI Official Synonym Full Names: dual specificity phosphatase 1
• NCBI Official Symbol: DUSP1
• NCBI Official Synonym Symbols: HVH1; MKP1; CL100; MKP-1; PTPN10
• NCBI Protein Information: dual specificity protein phosphatase 1
• UniProt Protein Name: Dual specificity protein phosphatase 1
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: DUSP1
• UniProt Synonym Gene Names: CL100; MKP1; PTPN10; VH1; MAP kinase phosphatase 1; MKP-1
• UniProt Entry Name: DUS1_HUMAN

NCBI Description

The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy. [provided by RefSeq, Aug 2017]

Uniprot Description

MKP-1: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP1 specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation. It is induced in human skin fibroblasts by oxidative/heat stress and growth factors. Contains 1 rhodanese domain.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tyrosine/threonine phosphatase activity; protein binding; protein tyrosine/serine/threonine phosphatase activity; non-membrane spanning protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity

Biological Process: response to light stimulus; negative regulation of MAP kinase activity; response to cAMP; response to retinoic acid; negative regulation of MAPKKK cascade; positive regulation of apoptosis; response to glucocorticoid stimulus; negative regulation of meiotic cell cycle; response to testosterone stimulus; protein amino acid dephosphorylation; response to estradiol stimulus; cellular response to hormone stimulus; regulation of apoptosis; response to hydrogen peroxide; endoderm formation; response to oxidative stress; response to calcium ion; negative regulation of apoptosis; inactivation of MAPK activity