Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.67kD).)

Mouse anti-Human DUSP1 Monoclonal Antibody | anti-DUSP1 antibody

DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) (Biotin)

Gene Names
DUSP1; HVH1; MKP1; CL100; MKP-1; PTPN10
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUSP1; Monoclonal Antibody; DUSP1 (Dual Specificity Protein Phosphatase 1; CL100; Dual Specificity Protein Phosphatase hVH1; HVH1; Mitogen-activated Protein Kinase Phosphatase 1; MAP Kinase Phosphatase 1; MKP1; MKP-1; Protein-tyrosine Phosphatase CL100; PTPN10; VH1) (Biotin); anti-DUSP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H7
Specificity
Recognizes human DUSP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
367
Applicable Applications for anti-DUSP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa305-367 from human DUSP1 (NP_004408) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.67kD).)

Testing Data

(Detection limit for recombinant GST tagged DUSP1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DUSP1 is 0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DUSP1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DUSP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DUSP1 HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DUSP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-DUSP1 antibody
The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.
Product Categories/Family for anti-DUSP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dual specificity protein phosphatase 1
NCBI Official Synonym Full Names
dual specificity phosphatase 1
NCBI Official Symbol
DUSP1
NCBI Official Synonym Symbols
HVH1; MKP1; CL100; MKP-1; PTPN10
NCBI Protein Information
dual specificity protein phosphatase 1
UniProt Protein Name
Dual specificity protein phosphatase 1
UniProt Gene Name
DUSP1
UniProt Synonym Gene Names
CL100; MKP1; PTPN10; VH1; MAP kinase phosphatase 1; MKP-1
UniProt Entry Name
DUS1_HUMAN

NCBI Description

The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy. [provided by RefSeq, Aug 2017]

Uniprot Description

MKP-1: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP1 specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation. It is induced in human skin fibroblasts by oxidative/heat stress and growth factors. Contains 1 rhodanese domain.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tyrosine/threonine phosphatase activity; protein binding; protein tyrosine/serine/threonine phosphatase activity; non-membrane spanning protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity

Biological Process: response to light stimulus; negative regulation of MAP kinase activity; response to cAMP; response to retinoic acid; negative regulation of MAPKKK cascade; positive regulation of apoptosis; response to glucocorticoid stimulus; negative regulation of meiotic cell cycle; response to testosterone stimulus; protein amino acid dephosphorylation; response to estradiol stimulus; cellular response to hormone stimulus; regulation of apoptosis; response to hydrogen peroxide; endoderm formation; response to oxidative stress; response to calcium ion; negative regulation of apoptosis; inactivation of MAPK activity

Research Articles on DUSP1

Similar Products

Product Notes

The DUSP1 dusp1 (Catalog #AAA6141622) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUSP1 dusp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUSP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.