Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)

Mouse anti-Human ADSSL1 Monoclonal Antibody | anti-ADSSL1 antibody

ADSSL1 (Adenylosuccinate Synthetase Isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate Synthetase, Basic Isozyme, Adenylosuccinate Synthetase, Muscle Isozyme, M-type Adenylosuccinate Synthetase, IMP--aspartate Ligase 1, ADSS1, FLJ38602) (FITC)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADSSL1; Monoclonal Antibody; ADSSL1 (Adenylosuccinate Synthetase Isozyme 1; AMPSase 1; AdSS 1; Adenylosuccinate Synthetase; Basic Isozyme; Muscle Isozyme; M-type Adenylosuccinate Synthetase; IMP--aspartate Ligase 1; ADSS1; FLJ38602) (FITC); anti-ADSSL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D12
Specificity
Recognizes human ADSSL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ADSSL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa369-437 from human ADSSL1 (NP_689541) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.59kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.59kD).)
Related Product Information for anti-ADSSL1 antibody
Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
Product Categories/Family for anti-ADSSL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,208 Da
NCBI Official Full Name
adenylosuccinate synthetase isozyme 1 isoform 2
NCBI Official Synonym Full Names
adenylosuccinate synthase like 1
NCBI Official Symbol
ADSSL1
NCBI Protein Information
adenylosuccinate synthetase isozyme 1; adSS 1; AMPSase 1; IMP--aspartate ligase 1; M-type adenylosuccinate synthetase; adenylosuccinate synthetase, basic isozyme; adenylosuccinate synthetase, muscle isozyme
UniProt Protein Name
Adenylosuccinate synthetase isozyme 1
UniProt Gene Name
ADSSL1
UniProt Synonym Gene Names
ADSS1; AMPSase 1; AdSS 1
UniProt Entry Name
PURA1_HUMAN

Uniprot Description

Function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP

By similarity. HAMAP-Rule MF_03126

Catalytic activity: GTP + IMP + L-aspartate = GDP + phosphate + N(6)-(1,2-dicarboxyethyl)-AMP. HAMAP-Rule MF_03126

Cofactor: Binds 1 magnesium ion per subunit

By similarity. HAMAP-Rule MF_03126

Pathway: Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 1/2. HAMAP-Rule MF_03126

Subunit structure: Homodimer

By similarity. HAMAP-Rule MF_03126

Subcellular location: Cytoplasm Ref.1.

Tissue specificity: Predominantly expressed in skeletal muscle and heart, as well as in several hematopoietic cell lines and solid tumors. Ref.1

Sequence similarities: Belongs to the adenylosuccinate synthetase family.

Sequence caution: The sequence AAH32039.1 differs from that shown. Reason: Frameshift at position 1. The sequence CAD62614.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The ADSSL1 adssl1 (Catalog #AAA6145812) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADSSL1 (Adenylosuccinate Synthetase Isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate Synthetase, Basic Isozyme, Adenylosuccinate Synthetase, Muscle Isozyme, M-type Adenylosuccinate Synthetase, IMP--aspartate Ligase 1, ADSS1, FLJ38602) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADSSL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADSSL1 adssl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADSSL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.