Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ASCL1 Monoclonal Antibody | anti-ASCL1 antibody

ASCL1 (Achaete Scute Protein, Achaete-scute Complex Homolog 1, Achaete-scute Complex-like 1, ASH1, HASH1, MASH1, BHLHa46) (Biotin)

Gene Names
ASCL1; ASH1; HASH1; MASH1; bHLHa46
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ASCL1; Monoclonal Antibody; ASCL1 (Achaete Scute Protein; Achaete-scute Complex Homolog 1; Achaete-scute Complex-like 1; ASH1; HASH1; MASH1; BHLHa46) (Biotin); anti-ASCL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C5
Specificity
Recognizes human ASCL1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ASCL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa137-236 from human ASCL1 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-ASCL1 antibody
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.
Product Categories/Family for anti-ASCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
429
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,454 Da
NCBI Official Full Name
achaete-scute homolog 1
NCBI Official Synonym Full Names
achaete-scute family bHLH transcription factor 1
NCBI Official Symbol
ASCL1
NCBI Official Synonym Symbols
ASH1; HASH1; MASH1; bHLHa46
NCBI Protein Information
achaete-scute homolog 1
UniProt Protein Name
Achaete-scute homolog 1
Protein Family
UniProt Gene Name
ASCL1
UniProt Synonym Gene Names
ASH1; BHLHA46ImportedManual assertion inferred from database entriesiHGNC:738; HASH11 PublicationManual assertion based on opinion iniRef.1; bHLHa46ImportedManual assertion inferred from database entriesiHGNC:738

NCBI Description

This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcription factor that plays a key role in neuronal differentiation: acts as a pioneer transcription factor, accessing closed chromatin to allow other factors to bind and activate neural pathways. Directly binds the E box motif (5'-CANNTG-3') on promoters and promotes transcription of neuronal genes. The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro. Plays a role at early stages of development of specific neural lineages in most regions of the CNS, and of several lineages in the PNS. Essential for the generation of olfactory and autonomic neurons. Acts synergistically with FOXN4 to specify the identity of V2b neurons rather than V2a from bipotential p2 progenitors during spinal cord neurogenesis, probably through DLL4-NOTCH signaling activation.

Research Articles on ASCL1

Similar Products

Product Notes

The ASCL1 ascl1 (Catalog #AAA6145350) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASCL1 (Achaete Scute Protein, Achaete-scute Complex Homolog 1, Achaete-scute Complex-like 1, ASH1, HASH1, MASH1, BHLHa46) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASCL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASCL1 ascl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASCL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.