Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TNFSF11 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human TNFSF11 Monoclonal Antibody | anti-TNFSF11 antibody

TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced Cytokine, TRANCE) (Biotin)

Gene Names
TNFSF11; ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFSF11; Monoclonal Antibody; TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11; CD254; Osteoclast Differentiation Factor; ODF; Osteoprotegerin Ligand; OPGL; Receptor Activator of Nuclear Factor kappa-B Ligand; RANKL; TNF-related Activation-induced Cytokine; TRANCE) (Biotin); sOdf; OPTB2; hRANKL2; anti-TNFSF11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F7
Specificity
Recognizes human TNFSF11.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TNFSF11 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa222-317 from TNFSF11 (NP_003692) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFSF11 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFSF11 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.56kD).)
Product Categories/Family for anti-TNFSF11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,478 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 11 isoform 1
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 11
NCBI Official Symbol
TNFSF11
NCBI Official Synonym Symbols
ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
NCBI Protein Information
tumor necrosis factor ligand superfamily member 11; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligan
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 11
UniProt Gene Name
TNFSF11
UniProt Synonym Gene Names
OPGL; RANKL; TRANCE; ODF; OPGL; RANKL; TRANCE
UniProt Entry Name
TNF11_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: extracellular space; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; cytokine and chemokine mediated signaling pathway; mammary gland epithelial cell proliferation; osteoclast differentiation; activation of JNK activity; positive regulation of homotypic cell-cell adhesion; positive regulation of corticotropin-releasing hormone secretion; activation of NF-kappaB transcription factor; calcium ion homeostasis; positive regulation of protein kinase B signaling cascade; positive regulation of MAP kinase activity; monocyte chemotaxis; organ morphogenesis; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; positive regulation of transcription factor activity; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of T cell activation; protein homooligomerization; bone resorption

Disease: Osteopetrosis, Autosomal Recessive 2

Research Articles on TNFSF11

Similar Products

Product Notes

The TNFSF11 tnfsf11 (Catalog #AAA6144850) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced Cytokine, TRANCE) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFSF11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFSF11 tnfsf11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFSF11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.