Mouse anti-Human TNFSF11 Monoclonal Antibody | anti-TNFSF11 antibody

TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11, CD254, Osteoclast Differentiation Factor, ODF, Osteoprotegerin Ligand, OPGL, Receptor Activator of Nuclear Factor kappa-B Ligand, RANKL, TNF-related Activation-induced Cytokine, TRANCE) APC

Cat. Num. AAA6139547

• Gene Names: TNFSF11; ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TNFSF11; Monoclonal Antibody; TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11; CD254; Osteoclast Differentiation Factor; ODF; Osteoprotegerin Ligand; OPGL; Receptor Activator of Nuclear Factor kappa-B Ligand; RANKL; TNF-related Activation-induced Cytokine; TRANCE) APC; sOdf; OPTB2; hRANKL2; anti-TNFSF11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F7
• Specificity: Recognizes human TNFSF11.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TNFSF11 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa222-317 from TNFSF11 (NP_003692) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFSF11 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen (36.56kD).)

Product Categories/Family for anti-TNFSF11 antibody

Antibodies; RANK

NCBI and Uniprot Product Information

• NCBI GI #: 4507595
• NCBI GeneID: 8600
• NCBI Accession #: NP_003692.1
• NCBI GenBank Nucleotide #: NM_003701
• UniProt Accession #: O14788; O14723; Q96Q17; Q9P2Q3
• Molecular Weight: 35,478 Da
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 11 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor (ligand) superfamily, member 11
• NCBI Official Symbol: TNFSF11
• NCBI Official Synonym Symbols: ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 11; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligan
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 11
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF11
• UniProt Synonym Gene Names: OPGL; RANKL; TRANCE; ODF; OPGL; RANKL; TRANCE
• UniProt Entry Name: TNF11_HUMAN

NCBI Description

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: extracellular space; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; cytokine and chemokine mediated signaling pathway; mammary gland epithelial cell proliferation; osteoclast differentiation; activation of JNK activity; positive regulation of homotypic cell-cell adhesion; positive regulation of corticotropin-releasing hormone secretion; activation of NF-kappaB transcription factor; calcium ion homeostasis; positive regulation of protein kinase B signaling cascade; positive regulation of MAP kinase activity; monocyte chemotaxis; organ morphogenesis; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; positive regulation of transcription factor activity; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of T cell activation; protein homooligomerization; bone resorption

Disease: Osteopetrosis, Autosomal Recessive 2