Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human SPRED2 Monoclonal Antibody | anti-SPRED2 antibody

SPRED2 (Sprouty-related, EVH1 Domain-containing Protein 2, Spred-2) (Biotin)

Gene Names
SPRED2; Spred-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SPRED2; Monoclonal Antibody; SPRED2 (Sprouty-related; EVH1 Domain-containing Protein 2; Spred-2) (Biotin); anti-SPRED2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G8
Specificity
Recognizes human SPRED2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SPRED2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
ELISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa120-220 from human SPRED2 (NP_861449) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged SPRED2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SPRED2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SPRED2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,033 Da
NCBI Official Full Name
sprouty-related, EVH1 domain-containing protein 2 isoform a
NCBI Official Synonym Full Names
sprouty-related, EVH1 domain containing 2
NCBI Official Symbol
SPRED2
NCBI Official Synonym Symbols
Spred-2
NCBI Protein Information
sprouty-related, EVH1 domain-containing protein 2; sprouty protein with EVH-1 domain 2, related sequence
UniProt Protein Name
Sprouty-related, EVH1 domain-containing protein 2
UniProt Gene Name
SPRED2
UniProt Synonym Gene Names
Spred-2
UniProt Entry Name
SPRE2_HUMAN

NCBI Description

SPRED2 is a member of the Sprouty (see SPRY1; MIM 602465)/SPRED family of proteins that regulate growth factor-induced activation of the MAP kinase cascade (see MAPK1; MIM 176948) (Nonami et al., 2004 [PubMed 15465815]).[supplied by OMIM, Mar 2008]

Uniprot Description

SPRED2: Tyrosine kinase substrate that inhibits growth-factor- mediated activation of MAP kinase. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p14

Cellular Component: nucleoplasm; cytoplasm; plasma membrane

Molecular Function: protein serine/threonine kinase inhibitor activity; protein binding; stem cell factor receptor binding; protein kinase binding

Biological Process: multicellular organismal development; positive regulation of DNA damage response, signal transduction by p53 class mediator; inactivation of MAPK activity

Research Articles on SPRED2

Similar Products

Product Notes

The SPRED2 spred2 (Catalog #AAA6144566) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SPRED2 (Sprouty-related, EVH1 Domain-containing Protein 2, Spred-2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SPRED2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). ELISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SPRED2 spred2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SPRED2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.