Mouse anti-Human LILRA3 Monoclonal Antibody | anti-LILRA3 antibody

LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (B

Cat. Num. AAA6142709

• Gene Names: LILRA3; HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LILRA3; Monoclonal Antibody; LILRA3 (ILT6; CD85e; Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3; CD85 Antigen-like Family Member E; Immunoglobulin-like Transcript 6; ILT-6; Leukocyte Immunoglobulin-like Receptor 4; LIR-4; Monocyte Inhibitory Receptor HM43/HM31; LIR4) (B; anti-LILRA3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E9
• Specificity: Recognizes human LILRA3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-LILRA3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant protein corresponding to aa1-439 from human LILRA3 (AAH28208) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (74.4kD).)

Western Blot (WB)

(Western Blot analysis of LILRA3 expression in transfected 293T cell line using129092 Lane 1: LILRA3 transfected lysate (50.485kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LILRA3 antibody

ILT6, also known as CD85e, LIR4, and LILRA3, contains four Ig-like C2-type domains and is the only ILT family member that lacks a transmembrane and cytoplasmic domain. ILT proteins modulate immune responses through interactions with class I MHC molecules. Several polymorphisms of ILT6 have been described, and loss of ILT6 is associated with the development of multiple sclerosis. Human and chimpanzee ILT6 share 84% aa sequence identity. ILT6 orthologs have not been described in other species.

Product Categories/Family for anti-LILRA3 antibody

Antibodies; CD Markers

References

1. Low HZ, et al., TLR8 regulation of LILRA3 in monocytes is abrogated in human immunodeficiency virus infection and correlates to CD4 counts and virus loads. Retrovirology. 2016 Mar 12; 13(1):15. 2. An H, et al., Serum Leukocyte Immunoglobulin-Like Receptor A3 (LILRA3) Is Increased in Patients with Multiple Sclerosis and Is a Strong Independent Indicator of Disease Severity; 6.7kbp LILRA3 Gene Deletion Is Not Associated with Diseases Susceptibility. PLoS One. 2016 Feb 12; 11(2):e0149200. 3. An H, et al., Soluble LILRA3 promotes neurite outgrowth and synapses formation through high affinity interaction with Nogo 66. Cell Sci. 2016 Jan 29.

NCBI and Uniprot Product Information

• NCBI GI #: 20381358
• NCBI GeneID: 11026
• Molecular Weight: 49,187 Da
• NCBI Official Full Name: Homo sapiens leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3, mRNA
• NCBI Official Synonym Full Names: leukocyte immunoglobulin like receptor A3
• NCBI Official Symbol: LILRA3
• NCBI Official Synonym Symbols: HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
• NCBI Protein Information: leukocyte immunoglobulin-like receptor subfamily A member 3
• Protein Family: Leukocyte immunoglobulin-like receptor subfamily

NCBI Description

This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]