Rabbit anti-Human LILRA3 Polyclonal Antibody | anti-LILRA3 antibody

LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4)

Cat. Num. AAA6010567

• Gene Names: LILRA3; e3; HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: LILRA3; Polyclonal Antibody; LILRA3 (ILT6; CD85e; Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3; CD85 Antigen-like Family Member E; Immunoglobulin-like Transcript 6; ILT-6; Leukocyte Immunoglobulin-like Receptor 4; LIR-4; Monocyte Inhibitory Receptor HM43/HM31; LIR4); Anti -LILRA3 (ILT6; anti-LILRA3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LILRA3.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

• Applicable Applications for anti-LILRA3 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human LILRA3, aa1-439 (NP_006856.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LILRA3 expression in transfected 293T cell line by LILRA3 polyclonal antibody. Lane 1: LILRA3 transfected lysate (47.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LILRA3 antibody

ILT6, also known as CD85e, LIR4, and LILRA3, contains four Ig-like C2-type domains and is the only ILT family member that lacks a transmembrane and cytoplasmic domain. ILT proteins modulate immune responses through interactions with class I MHC molecules. Several polymorphisms of ILT6 have been described, and loss of ILT6 is associated with the development of multiple sclerosis. Human and chimpanzee ILT6 share 84% aa sequence identity. ILT6 orthologs have not been described in other species.

Product Categories/Family for anti-LILRA3 antibody

Antibodies; Abs to CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 289547633
• NCBI GeneID: 11026
• NCBI Accession #: NP_001166125.1
• NCBI GenBank Nucleotide #: NM_001172654.1
• UniProt Accession #: Q8N6C8; O15469; O15470; O75016; Q8N151; Q8N154; Q8NHJ1; Q8NHJ2; Q8NHJ3; Q8NHJ4; J3KPM2
• Molecular Weight: 47,472 Da
• NCBI Official Full Name: leukocyte immunoglobulin-like receptor subfamily A member 3 isoform 2
• NCBI Official Synonym Full Names: leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
• NCBI Official Symbol: LILRA3
• NCBI Official Synonym Symbols: e3; HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
• NCBI Protein Information: leukocyte immunoglobulin-like receptor subfamily A member 3; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3
• UniProt Protein Name: Leukocyte immunoglobulin-like receptor subfamily A member 3
• Protein Family: Leukocyte immunoglobulin-like receptor subfamily
• UniProt Gene Name: LILRA3
• UniProt Synonym Gene Names: ILT6; LIR4; ILT-6; LIR-4
• UniProt Entry Name: LIRA3_HUMAN

NCBI Description

Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades (see LILRA1, MIM 604810). One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor (Borges et al., 1997 [PubMed 9548455]).[supplied by OMIM, Mar 2008]

Uniprot Description

LILRA3: May act as soluble receptor for class I MHC antigens.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: plasma membrane; extracellular region

Molecular Function: receptor activity; antigen binding

Biological Process: immune system process; defense response; signal transduction