Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.4kD).)

Mouse anti-Human KNG1 Monoclonal Antibody | anti-KNG1 antibody

KNG1 (BDK, KNG, Kininogen-1, Alpha-2-thiol Proteinase Inhibitor, Fitzgerald Factor, High Molecular Weight Kininogen, Williams-Fitzgerald-Flaujeac Factor, Kininogen-1 Heavy Chain, T-kinin, Ile-Ser-Bradykinin, Bradykinin, Kallidin I, Lysyl-bradykinin, Kalli

Gene Names
KNG1; BK; BDK; KNG
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KNG1; Monoclonal Antibody; KNG1 (BDK; KNG; Kininogen-1; Alpha-2-thiol Proteinase Inhibitor; Fitzgerald Factor; High Molecular Weight Kininogen; Williams-Fitzgerald-Flaujeac Factor; Kininogen-1 Heavy Chain; T-kinin; Ile-Ser-Bradykinin; Bradykinin; Kallidin I; Lysyl-bradykinin; Kalli; anti-KNG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Specificity
Recognizes human KNG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-KNG1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa322-427 from human KNG1 (NP_000884.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.4kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.4kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of KNG1 transfected lysate using KNG1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KNG1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of KNG1 transfected lysate using KNG1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KNG1 rabbit polyclonal antibody.)
Related Product Information for anti-KNG1 antibody
This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KNG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,957 Da
NCBI Official Full Name
kininogen-1 isoform 2
NCBI Official Synonym Full Names
kininogen 1
NCBI Official Symbol
KNG1
NCBI Official Synonym Symbols
BK; BDK; KNG
NCBI Protein Information
kininogen-1; HMWK; bradykinin; fitzgerald factor; high molecular weight kininogen; alpha-2-thiol proteinase inhibitor; williams-Fitzgerald-Flaujeac factor
UniProt Protein Name
Kininogen-1
Protein Family
UniProt Gene Name
KNG1
UniProt Synonym Gene Names
BDK; KNG; HMWK
UniProt Entry Name
KNG1_HUMAN

NCBI Description

This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

Uniprot Description

KNG1: (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting. Defects in KNG1 are the cause of high molecular weight kininogen deficiency (HMWK deficiency). HMWK deficiency is an autosomal recessive coagulation defect. Patients with HWMK deficiency do not have a hemorrhagic tendency, but they exhibit abnormal surface-mediated activation of fibrinolysis. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Secreted; Inhibitor; Secreted, signal peptide; Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space; plasma membrane; extracellular region

Molecular Function: heparin binding; protein binding; zinc ion binding; cysteine protease inhibitor activity; receptor binding

Biological Process: negative regulation of proteolysis; platelet activation; elevation of cytosolic calcium ion concentration; smooth muscle contraction; platelet degranulation; positive regulation of apoptosis; negative regulation of blood coagulation; negative regulation of cell adhesion; blood coagulation; inflammatory response; vasodilation; blood coagulation, intrinsic pathway

Disease: High Molecular Weight Kininogen Deficiency

Research Articles on KNG1

Similar Products

Product Notes

The KNG1 kng1 (Catalog #AAA6142634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KNG1 (BDK, KNG, Kininogen-1, Alpha-2-thiol Proteinase Inhibitor, Fitzgerald Factor, High Molecular Weight Kininogen, Williams-Fitzgerald-Flaujeac Factor, Kininogen-1 Heavy Chain, T-kinin, Ile-Ser-Bradykinin, Bradykinin, Kallidin I, Lysyl-bradykinin, Kalli reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KNG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KNG1 kng1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KNG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.