Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human ISL2 Monoclonal Antibody | anti-ISL2 antibody

ISL2 (Insulin Gene Enhancer Protein ISL-2, Islet-2, FLJ10160) (Biotin)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ISL2; Monoclonal Antibody; ISL2 (Insulin Gene Enhancer Protein ISL-2; Islet-2; FLJ10160) (Biotin); anti-ISL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D9
Specificity
Recognizes human ISL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ISL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa261-359 from human ISL2 (NP_665804) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of ISL2 expression in transfected 293T cell line by ISL2 monoclonal antibody. Lane 1: ISL2 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ISL2 expression in transfected 293T cell line by ISL2 monoclonal antibody. Lane 1: ISL2 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ISL2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ISL2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-ISL2 antibody
ISL2 is a transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways (By similarity).
Product Categories/Family for anti-ISL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,768 Da
NCBI Official Full Name
insulin gene enhancer protein ISL-2
NCBI Official Synonym Full Names
ISL LIM homeobox 2
NCBI Official Symbol
ISL2
NCBI Protein Information
insulin gene enhancer protein ISL-2; islet-2; ISL2 transcription factor, LIM/homeodomain, (islet-2)
UniProt Protein Name
Insulin gene enhancer protein ISL-2
UniProt Gene Name
ISL2
UniProt Synonym Gene Names
Islet-2
UniProt Entry Name
ISL2_HUMAN

Uniprot Description

islet-2: Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleus

Molecular Function: DNA binding; zinc ion binding; sequence-specific DNA binding

Biological Process: peripheral nervous system neuron development; negative regulation of neuron differentiation; visceral motor neuron differentiation; regulation of transcription, DNA-dependent; spinal cord motor neuron cell fate specification; neuron development; retinal ganglion cell axon guidance

Research Articles on ISL2

Similar Products

Product Notes

The ISL2 isl2 (Catalog #AAA6142515) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ISL2 (Insulin Gene Enhancer Protein ISL-2, Islet-2, FLJ10160) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ISL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ISL2 isl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ISL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.