Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ISL2 rabbit polyclonal antibody. Western Blot analysis of ISL2 expression in human kidney.)

Rabbit anti-Human, Mouse ISL2 Polyclonal Antibody | anti-ISL2 antibody

ISL2 (Insulin Gene Enhancer Protein ISL-2, Islet-2, FLJ10160) (AP)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ISL2; Polyclonal Antibody; ISL2 (Insulin Gene Enhancer Protein ISL-2; Islet-2; FLJ10160) (AP); anti-ISL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ISL2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ISL2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ISL2, aa1-359 (NP_665804.1).
Immunogen Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ISL2 rabbit polyclonal antibody. Western Blot analysis of ISL2 expression in human kidney.)

Western Blot (WB) (ISL2 rabbit polyclonal antibody. Western Blot analysis of ISL2 expression in human kidney.)

Western Blot (WB)

(ISL2 rabbit polyclonal antibody. Western Blot analysis of ISL2 expression in mouse liver.)

Western Blot (WB) (ISL2 rabbit polyclonal antibody. Western Blot analysis of ISL2 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ISL2 expression in transfected 293T cell line by ISL2 polyclonal antibody. Lane 1: ISL2 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ISL2 expression in transfected 293T cell line by ISL2 polyclonal antibody. Lane 1: ISL2 transfected lysate (39.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ISL2 antibody
ISL2 is a transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways (By similarity).
Product Categories/Family for anti-ISL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,768 Da
NCBI Official Full Name
insulin gene enhancer protein ISL-2
NCBI Official Synonym Full Names
ISL LIM homeobox 2
NCBI Official Symbol
ISL2
NCBI Protein Information
insulin gene enhancer protein ISL-2; islet-2; ISL2 transcription factor, LIM/homeodomain, (islet-2)
UniProt Protein Name
Insulin gene enhancer protein ISL-2
UniProt Gene Name
ISL2
UniProt Synonym Gene Names
Islet-2
UniProt Entry Name
ISL2_HUMAN

Uniprot Description

islet-2: Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 15q23

Cellular Component: nucleus

Molecular Function: DNA binding; zinc ion binding; sequence-specific DNA binding

Biological Process: peripheral nervous system neuron development; negative regulation of neuron differentiation; visceral motor neuron differentiation; regulation of transcription, DNA-dependent; spinal cord motor neuron cell fate specification; neuron development; retinal ganglion cell axon guidance

Research Articles on ISL2

Similar Products

Product Notes

The ISL2 isl2 (Catalog #AAA6383168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISL2 (Insulin Gene Enhancer Protein ISL-2, Islet-2, FLJ10160) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ISL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ISL2 isl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ISL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.