Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Mouse anti-Human, Rat ING3 Monoclonal Antibody | anti-ING3 antibody

ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (Biotin)

Gene Names
ING3; Eaf4; ING2; MEAF4; p47ING3
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ING3; Monoclonal Antibody; ING3 (Inhibitor of Growth Protein 3; p47ING3; HSPC301; FLJ20089; ING2) (Biotin); anti-ING3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C4
Specificity
Recognizes human ING3. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
92
Applicable Applications for anti-ING3 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-93 from human ING3 (NP_938008) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.23kD).)

Western Blot (WB)

(ING3 monoclonal antibody, Western Blot analysis of ING3 expression in PC-12.)

Western Blot (WB) (ING3 monoclonal antibody, Western Blot analysis of ING3 expression in PC-12.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ING3 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ING3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ING3 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ING3 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-ING3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
inhibitor of growth protein 3 isoform 3
NCBI Official Synonym Full Names
inhibitor of growth family member 3
NCBI Official Symbol
ING3
NCBI Official Synonym Symbols
Eaf4; ING2; MEAF4; p47ING3
NCBI Protein Information
inhibitor of growth protein 3
UniProt Protein Name
Inhibitor of growth protein 3
UniProt Gene Name
ING3
UniProt Entry Name
ING3_HUMAN

NCBI Description

The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

ING3: Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Defects in ING3 may be a cause of head and neck squamous cell carcinomas (HNSCC); also known as squamous cell carcinoma of the head and neck. Belongs to the ING family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 7q31

Cellular Component: nucleoplasm; NuA4 histone acetyltransferase complex; cytoplasm; nucleolus; nucleus

Molecular Function: histone acetyltransferase activity; zinc ion binding; methylated histone residue binding

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of apoptosis; regulation of growth

Research Articles on ING3

Similar Products

Product Notes

The ING3 ing3 (Catalog #AAA6142481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (Biotin) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ING3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ING3 ing3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ING3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.