Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.32kD).)

Mouse anti-Human IL13 Monoclonal Antibody | anti-IL13 antibody

IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (Biotin)

Gene Names
IL13; P600; IL-13
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IL13; Monoclonal Antibody; IL13 (Interleukin-13; Interleukin 13; NC30; IL-13; MGC116786; MGC116788; MGC116789) (Biotin); anti-IL13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H7
Specificity
Recognizes human IL13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
146
Applicable Applications for anti-IL13 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-146 from human IL13 (NP_002179) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.32kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.32kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IL13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to IL13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])
Product Categories/Family for anti-IL13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-13 isoform 1
NCBI Official Synonym Full Names
interleukin 13
NCBI Official Symbol
IL13
NCBI Official Synonym Symbols
P600; IL-13
NCBI Protein Information
interleukin-13
UniProt Protein Name
Interleukin-13
Protein Family
UniProt Gene Name
IL13
UniProt Synonym Gene Names
NC30; IL-13
UniProt Entry Name
IL13_HUMAN

NCBI Description

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008]

Uniprot Description

IL13: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Defects in IL13 may be a cause of susceptibility to allergic rhinitis (ALRH). Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure. Belongs to the IL-4/IL-13 family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: extracellular space; cytoplasm; extracellular region; external side of plasma membrane

Molecular Function: protein binding; interleukin-13 receptor binding; cytokine activity

Biological Process: response to nicotine; positive regulation of smooth muscle cell proliferation; microglial cell activation; regulation of proton transport; response to lipopolysaccharide; signal transduction; positive regulation of connective tissue growth factor production; positive regulation of tyrosine phosphorylation of Stat6 protein; positive regulation of immunoglobulin production; response to ethanol; cell-cell signaling; positive regulation of protein secretion; positive regulation of B cell proliferation; immune response; positive regulation of release of sequestered calcium ion into cytosol; negative regulation of NAD(P)H oxidase activity; inflammatory response; cell motility; positive regulation of macrophage activation

Disease: Asthma, Susceptibility To; Allergic Rhinitis

Research Articles on IL13

Similar Products

Product Notes

The IL13 il13 (Catalog #AAA6142445) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IL13 (Interleukin-13, Interleukin 13, NC30, IL-13, MGC116786, MGC116788, MGC116789) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL13 il13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IL13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.