Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse anti-Human GCH1 Monoclonal Antibody | anti-GCH1 antibody

GCH1 (GTP Cyclohydrolase 1, GTP Cyclohydrolase I, GTP-CH-I, DYT5, GCH) (Biotin)

Gene Names
GCH1; GCH; DYT5; DYT14; DYT5a; GTPCH1; HPABH4B; GTP-CH-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
GCH1; Monoclonal Antibody; GCH1 (GTP Cyclohydrolase 1; GTP Cyclohydrolase I; GTP-CH-I; DYT5; GCH) (Biotin); anti-GCH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A12
Specificity
Recognizes human GCH1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GCH1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa84-172 from human GCH1 (NP_000152) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(Western Blot analysis of GCH1 using 127227 expression in IMR-32.)

Western Blot (WB) (Western Blot analysis of GCH1 using 127227 expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of GCH1 expression in transfected 293T cell line using 127227. Lane 1: GCH1 transfected lysate (27.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GCH1 expression in transfected 293T cell line using 127227. Lane 1: GCH1 transfected lysate (27.9kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human lymph node using 127227 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase on formalin-fixed paraffin-embedded human lymph node using 127227 (3ug/ml).)

Immunoprecipitation (IP)

(Immunoprecipitation of GCH1 transfected lysate using 127227and Protein A Magnetic Bead and immunoblotted with GCH1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GCH1 transfected lysate using 127227and Protein A Magnetic Bead and immunoblotted with GCH1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GCH1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GCH1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GCH1 antibody
References
1. Vascular Dysfunction in Streptozotocin-Induced Experimental Diabetes Strictly Depends on Insulin Deficiency. Oelze M, Knorr M, Schuhmacher S, Heeren T, Otto C, Schulz E, Reifenberg K, Wenzel P, Munzel T, Daiber A.J Vasc Res. 2011 Jan 27;48(4):275-284.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
GTP cyclohydrolase 1
NCBI Official Synonym Full Names
GTP cyclohydrolase 1
NCBI Official Symbol
GCH1
NCBI Official Synonym Symbols
GCH; DYT5; DYT14; DYT5a; GTPCH1; HPABH4B; GTP-CH-1
NCBI Protein Information
GTP cyclohydrolase 1
UniProt Protein Name
GTP cyclohydrolase 1
Protein Family
UniProt Gene Name
GCH1
UniProt Synonym Gene Names
DYT5; GCH
UniProt Entry Name
GCH1_HUMAN

NCBI Description

This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. [provided by RefSeq, Jul 2008]

Research Articles on GCH1

Similar Products

Product Notes

The GCH1 gch1 (Catalog #AAA6142044) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GCH1 (GTP Cyclohydrolase 1, GTP Cyclohydrolase I, GTP-CH-I, DYT5, GCH) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCH1 gch1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.