Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2) Recombinant Protein | MYL2 recombinant protein

Recombinant Human Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), partial

Cat. Num. AAA717644

• Gene Names: MYL2; MLC2; CMH10; MLC-2s/v
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myosin regulatory light chain 2; ventricular/cardiac muscle isoform (MYL2); Recombinant Human Myosin regulatory light chain 2; partial; MYL2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 8-164. Partial.
• Sequence: KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGK GVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE
• Sequence Length: 164

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Product Categories/Family for MYL2 recombinant protein

Cardiovascular

References

Isolation and nucleotide sequence of the cDNA encoding human ventricular myosin light chain 2.Libera L.D., Hoffmann E., Floroff M., Jackowski G.Nucleic Acids Res. 17:2360-2360(1989) Wu Q.L. Margossian S.S., Umeda P.K., Sciaky D., Anderson P.A.W.Interaction of a conserved peptide domain in recombinant human ventricular myosin light chain-2 with myosin heavy chain.Wadgaonkar R., Shafiq S., Rajmanickam C., Siddiqui M.A.Cell. Mol. Biol. Res. 39:13-26(1993) The major protein expression profile and two-dimensional protein database of human heart.Kovalyov L.I., Shishkin S.S., Efimochkin A.S., Kovalyova M.A., Ershova E.S., Egorov T.A., Musalyamov A.K.Electrophoresis 16:1160-1169(1995) Protein interactions with myocilin.Wentz-Hunter K., Ueda J., Yue B.Y.Invest. Ophthalmol. Vis. Sci. 43:176-182(2002) Mutations in either the essential or regulatory light chains of myosin are associated with a rare myopathy in human heart and skeletal muscle.Poetter K., Jiang H., Hassanzadeh S., Master S.R., Chang A., Dalakas M.C., Rayment I., Sellers J.R., Fananapazir L., Epstein N.D.Nat. Genet. 13:63-69(1996) Identification of two novel mutations in the ventricular regulatory myosin light chain gene (MYL2) associated with familial and classical forms of hypertrophic cardiomyopathy.Flavigny J., Richard P., Isnard R., Carrier L., Charron P., Bonne G., Forissier J.F., Desnos M., Dubourg O., Komajda M., Schwartz K., Hainque B.J. Mol. Med. 76:208-214(1998) Systematic analysis of the regulatory and essential myosin light chain genes genetic variants and mutations in hypertrophic cardiomyopathy.Kabaeva Z.T., Perrot A., Wolter B., Dietz R., Cardim N., Correia J.M., Schulte H.D., Aldashev A.A., Mirrakhimov M.M., Osterziel K.J.Eur. J. Hum. Genet. 10:741-748(2002) Hypertrophic cardiomyopathy distribution of disease genes, spectrum of mutations, and implications for a molecular diagnosis strategy.Richard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 107:2227-2232(2003) ErratumRichard P., Charron P., Carrier L., Ledeuil C., Cheav T., Pichereau C., Benaiche A., Isnard R., Dubourg O., Burban M., Gueffet J.-P., Millaire A., Desnos M., Schwartz K., Hainque B., Komajda M.Circulation 109:3258-3258(2004) Identification of the genotypes causing hypertrophic cardiomyopathy in northern Sweden.Moerner S., Richard P., Kazzam E., Hellman U., Hainque B., Schwartz K., Waldenstroem A.J. Mol. Cell. Cardiol. 35:841-849(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 94981553
• NCBI GeneID: 4633
• NCBI Accession #: NP_000423.2
• NCBI GenBank Nucleotide #: NM_000432.3
• UniProt Accession #: P10916; Q16123
• Molecular Weight: 21.8 kDa
• NCBI Official Full Name: myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• NCBI Official Synonym Full Names: myosin light chain 2
• NCBI Official Symbol: MYL2
• NCBI Official Synonym Symbols: MLC2; CMH10; MLC-2s/v
• NCBI Protein Information: myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• UniProt Protein Name: Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• Protein Family: Myosin regulatory
• UniProt Gene Name: MYL2
• UniProt Synonym Gene Names: MLC-2s/v
• UniProt Entry Name: MLRV_HUMAN

NCBI Description

Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

MRLC2V: myosin regulatory light chain 2, ventricular/cardiac muscle isoform. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Protein type: Contractile

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: A band; actin cytoskeleton; cytoskeleton; cytosol; myofibril; myosin complex; sarcomere

Molecular Function: actin monomer binding; calcium ion binding; myosin heavy chain binding; protein binding; structural constituent of muscle

Biological Process: cardiac muscle contraction; cardiac myofibril assembly; heart contraction; heart development; muscle cell fate specification; muscle fiber development; muscle filament sliding; negative regulation of cell growth; post-embryonic development; regulation of striated muscle contraction; regulation of the force of heart contraction; ventricular cardiac muscle morphogenesis

Disease: Cardiomyopathy, Familial Hypertrophic, 10