Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Mouse anti-Human, Rat DAP5 Monoclonal Antibody | anti-DAP5 antibody

DAP5 (Eukaryotic Translation Initiation Factor 4 gamma 2, eIF-4-gamma 2, eIF-4G 2, eIF4G 2, Death-associated Protein 5, DAP-5, p97, EIF4G2, OK/SW-cl.75) (Biotin)

Gene Names
EIF4G2; P97; AAG1; DAP5; NAT1
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DAP5; Monoclonal Antibody; DAP5 (Eukaryotic Translation Initiation Factor 4 gamma 2; eIF-4-gamma 2; eIF-4G 2; eIF4G 2; Death-associated Protein 5; DAP-5; p97; EIF4G2; OK/SW-cl.75) (Biotin); anti-DAP5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B5
Specificity
Recognizes human EIF4G2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DAP5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa811-889 from human EIF4G2 (NP_001409) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB)

(EIF4G2 monoclonal antibody. Western Blot analysis of EIF4G2 expression in PC-12.)

Western Blot (WB) (EIF4G2 monoclonal antibody. Western Blot analysis of EIF4G2 expression in PC-12.)

Western Blot (WB)

(EIF4G2 monoclonal antibody Western Blot analysis of EIF4G2 expression in HeLa NE.)

Western Blot (WB) (EIF4G2 monoclonal antibody Western Blot analysis of EIF4G2 expression in HeLa NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-DAP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
98,150 Da
NCBI Official Full Name
eukaryotic translation initiation factor 4 gamma 2 isoform 1
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4 gamma, 2
NCBI Official Symbol
EIF4G2
NCBI Official Synonym Symbols
P97; AAG1; DAP5; NAT1
NCBI Protein Information
eukaryotic translation initiation factor 4 gamma 2; DAP-5; EIF4G2; aging-associated protein 1; death-associated protein 5; eIF-4-gamma 2; eIF-4G 2; eIF4G 2; eukaryotic translation initiation factor 4G-like 1
UniProt Protein Name
Eukaryotic translation initiation factor 4 gamma 2
UniProt Gene Name
EIF4G2
UniProt Synonym Gene Names
eIF-4-gamma 2; eIF-4G 2; eIF4G 2; DAP-5
UniProt Entry Name
IF4G2_HUMAN

Similar Products

Product Notes

The DAP5 eif4g2 (Catalog #AAA6141464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DAP5 (Eukaryotic Translation Initiation Factor 4 gamma 2, eIF-4-gamma 2, eIF-4G 2, eIF4G 2, Death-associated Protein 5, DAP-5, p97, EIF4G2, OK/SW-cl.75) (Biotin) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DAP5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DAP5 eif4g2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DAP5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.