Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection using 124588 against Immunogen (43.78kD).)

Mouse anti-Human CD247 Monoclonal Antibody | anti-CD247 antibody

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (Biotin)

Gene Names
CD247; T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD247; Monoclonal Antibody; CD247 (T-cell Surface Glycoprotein CD3 zeta Chain; T-cell Receptor T3 zeta Chain; CD3Z; T3Z; TCRZ) (Biotin); anti-CD247 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4A12-F6
Specificity
Recognizes human CD3Z.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CD247 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-164 from human CD3Z with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection using 124588 against Immunogen (43.78kD).)

Western Blot (WB) (Western Blot detection using 124588 against Immunogen (43.78kD).)

Western Blot (WB)

(Western Blot analysis of CD3Z expression in Jurkat using 124588.)

Western Blot (WB) (Western Blot analysis of CD3Z expression in Jurkat using 124588.)

Western Blot (WB)

(Western Blot analysis of CD247 expression in transfected 293T cell line by 124588. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD247 expression in transfected 293T cell line by 124588. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of 124588 on formalin-fixed paraffin-embedded human lymph node tissue (5ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase of 124588 on formalin-fixed paraffin-embedded human lymph node tissue (5ug/ml).)

Immunoprecipitation (IP)

(Immunoprecipitation of CD247 transfected lysate using 124588 and Protein A Magnetic Bead and immunoblotted with CD247 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CD247 transfected lysate using 124588 and Protein A Magnetic Bead and immunoblotted with CD247 rabbit polyclonal antibody.)
Product Categories/Family for anti-CD247 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
919
Molecular Weight
– Da
NCBI Official Full Name
Homo sapiens CD247 molecule, mRNA
NCBI Official Synonym Full Names
CD247 molecule
NCBI Official Symbol
CD247
NCBI Official Synonym Symbols
T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
NCBI Protein Information
T-cell surface glycoprotein CD3 zeta chain

NCBI Description

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on CD247

Similar Products

Product Notes

The CD247 (Catalog #AAA6141046) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD247 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD247 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD247, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.