Mouse anti-Human CD247 Monoclonal Antibody | anti-CD247 antibody

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (HRP)

Cat. Num. AAA6151652

• Gene Names: CD247; T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD247; Monoclonal Antibody; CD247 (T-cell Surface Glycoprotein CD3 zeta Chain; T-cell Receptor T3 zeta Chain; CD3Z; T3Z; TCRZ) (HRP); anti-CD247 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A12-F6
• Specificity: Recognizes human CD3Z.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CD247 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-164 from human CD3Z with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection using 124588 against Immunogen (43.78kD).)

Western Blot (WB)

(Western Blot analysis of CD3Z expression in Jurkat using 124588.)

Western Blot (WB)

(Western Blot analysis of CD247 expression in transfected 293T cell line by 124588. Lane 1: CD247 transfected lysate (18.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of 124588 on formalin-fixed paraffin-embedded human lymph node tissue (5ug/ml).)

Immunoprecipitation (IP)

(Immunoprecipitation of CD247 transfected lysate using 124588 and Protein A Magnetic Bead and immunoblotted with CD247 rabbit polyclonal antibody.)

Product Categories/Family for anti-CD247 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 19344013
• NCBI GeneID: 919
• Molecular Weight: – Da
• NCBI Official Full Name: Homo sapiens CD247 molecule, mRNA
• NCBI Official Synonym Full Names: CD247 molecule
• NCBI Official Symbol: CD247
• NCBI Official Synonym Symbols: T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3-ZETA
• NCBI Protein Information: T-cell surface glycoprotein CD3 zeta chain
• Protein Family: T-cell surface glycoprotein

NCBI Description

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]