Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Mouse anti-Human ARNT Monoclonal Antibody | anti-ARNT antibody

ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (Biotin)

Gene Names
ARNT; HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARNT; Monoclonal Antibody; ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator; ARNT Protein; Class E Basic Helix-loop-helix Protein 2; bHLHe2; Dioxin Receptor; Nuclear Translocator; Hypoxia-inducible Factor 1-beta; HIF-1-beta; HIF1-beta; BHLHE2) (Biotin); anti-ARNT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes human ARNT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ARNT antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73kD).)

Western Blot (WB)

(ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.)

Western Blot (WB) (ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod)

Testing Data (Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod)

Western Blot (WB)

(Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-ARNT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
405
Molecular Weight
86,366 Da
NCBI Official Full Name
Homo sapiens aryl hydrocarbon receptor nuclear translocator, mRNA
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator
NCBI Official Symbol
ARNT
NCBI Official Synonym Symbols
HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator; class E basic helix-loop-helix protein 2; dioxin receptor, nuclear translocator; hypoxia-inducible factor 1, beta subunit

NCBI Description

This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]

Research Articles on ARNT

Similar Products

Product Notes

The ARNT (Catalog #AAA6140676) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARNT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARNT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARNT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.