Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Mouse anti-Human ADK Monoclonal Antibody | anti-ADK antibody
ADK (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase) (Biotin)
Gene Names
ADK; AK
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADK; Monoclonal Antibody; ADK (Adenosine Kinase; AK; Adenosine 5'-phosphotransferase) (Biotin); anti-ADK antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E7
Specificity
Recognizes human ADK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ADK antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa236-345 from human ADK (NP_001114) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.84kD).)
Testing Data
(Detection limit for recombinant GST tagged ADK is ~10ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ADK is ~10ng/ml as a capture antibody.)
Related Product Information for anti-ADK antibody
Adenosine kinase is an abundant enzyme in mammalian tissues. The enzyme catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Alternative splicing results in two transcript variants encoding different isoforms. Both isoforms of the enzyme phosphorylate adenosine with identical kinetics and both require Mg2+ for activity.
Product Categories/Family for anti-ADK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,580 Da
NCBI Official Full Name
adenosine kinase isoform a
NCBI Official Synonym Full Names
adenosine kinase
NCBI Official Symbol
ADK
NCBI Official Synonym Symbols
AK
NCBI Protein Information
adenosine kinase; adenosine 5'-phosphotransferase
UniProt Protein Name
Adenosine kinase
UniProt Gene Name
ADK
UniProt Synonym Gene Names
AK
UniProt Entry Name
ADK_HUMAN
Similar Products
Product Notes
The ADK adk (Catalog #AAA6140501) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADK (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADK adk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
