Mouse anti-Human TLX3 Monoclonal Antibody | anti-TLX3 antibody

TLX3 (T-cell Leukemia Homeobox Protein 3, Homeobox Protein Hox-11L2, HOX11L2, RNX) APC

Cat. Num. AAA6139529

• Gene Names: TLX3; RNX; HOX11L2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TLX3; Monoclonal Antibody; TLX3 (T-cell Leukemia Homeobox Protein 3; Homeobox Protein Hox-11L2; HOX11L2; RNX) APC; anti-TLX3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A3
• Specificity: Recognizes human TLX3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TLX3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa192-292 from human TLX3 (NP_066305) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(TLX3 monoclonal antibody, Western Blot analysis of TLX3 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of TLX3 expression in transfected 293T cell line by TLX3 monoclonal antibody. Lane 1: TLX3 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TLX3 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TLX3 over-expressed 293 cell line, cotransfected with TLX3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TLX3 monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-TLX3 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 50355978
• NCBI GeneID: 30012
• NCBI Accession #: NP_066305
• NCBI GenBank Nucleotide #: NM_021025
• UniProt Accession #: O43711; Q96AD3
• Molecular Weight: Predicted: 32 kDa; ; Observed: 30 kDa
• NCBI Official Full Name: T-cell leukemia homeobox protein 3
• NCBI Official Synonym Full Names: T-cell leukemia homeobox 3
• NCBI Official Symbol: TLX3
• NCBI Official Synonym Symbols: RNX; HOX11L2
• NCBI Protein Information: T-cell leukemia homeobox protein 3; homeo box 11-like 2; homeobox protein Hox-11L2; T-cell leukemia, homeobox 3
• UniProt Protein Name: T-cell leukemia homeobox protein 3
• Protein Family: T-cell leukemia homeobox protein
• UniProt Gene Name: TLX3
• UniProt Synonym Gene Names: HOX11L2
• UniProt Entry Name: TLX3_HUMAN

NCBI Description

RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]).[supplied by OMIM, Mar 2008]

Uniprot Description

TLX3:

Protein type: Transcription factor; Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: negative regulation of neuron differentiation; central nervous system development; regulation of transcription, DNA-dependent; neuron migration; neuron fate specification; neurological control of breathing; respiratory gaseous exchange