Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human Nibrin Monoclonal Antibody | anti-NBN antibody

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (FITC)

Gene Names
NBN; ATV; NBS; P95; NBS1; AT-V1; AT-V2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Nibrin; Monoclonal Antibody; Nibrin (ATV; AT-V1; AT-V2; Cell Cycle Regulatory Protein p95; FLJ10155; MGC87362; NBN; Nijmegen Breakage Syndrome; NBS; Nijmegen Breakage Syndrome Protein 1; NBS1; p95 NBS1) (FITC); anti-NBN antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E4
Specificity
Recognizes human NBN.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-NBN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa645-754 from human NBN (NP_002476) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(NBN monoclonal antibody Western Blot analysis of NBN expression in COLO 320 HSR.)

Western Blot (WB) (NBN monoclonal antibody Western Blot analysis of NBN expression in COLO 320 HSR.)

Western Blot (WB)

(NBN monoclonal antibody Western Blot analysis of NBN expression in HL-60.)

Western Blot (WB) (NBN monoclonal antibody Western Blot analysis of NBN expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged NBN is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NBN is ~3ng/ml as a capture antibody.)
Related Product Information for anti-NBN antibody
Mutations in this Nibrin (NBN) are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.
Product Categories/Family for anti-NBN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,959 Da
NCBI Official Full Name
nibrin
NCBI Official Synonym Full Names
nibrin
NCBI Official Symbol
NBN
NCBI Official Synonym Symbols
ATV; NBS; P95; NBS1; AT-V1; AT-V2
NCBI Protein Information
nibrin; cell cycle regulatory protein p95; Nijmegen breakage syndrome 1 (nibrin); p95 protein of the MRE11/RAD50 complex
UniProt Protein Name
Nibrin
Protein Family
UniProt Gene Name
NBN
UniProt Synonym Gene Names
NBS; NBS1; P95
UniProt Entry Name
NBN_HUMAN

NCBI Description

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. [provided by RefSeq, Jul 2008]

Uniprot Description

NBS1: a member of the MRE11/RAD50 double-strand break repair complex. Involved in DNA double-strand break repair and DNA damage-induced checkpoint activation. Mutation results in the Nijmegen breakage syndrome (NBS), an autosomal recessive chromosomal instability syndrome.

Protein type: Cell cycle regulation; DNA repair, damage

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: nucleoplasm; PML body; Mre11 complex; nuclear chromosome, telomeric region; nucleolus; replication fork; nucleus; nuclear inclusion body

Molecular Function: ATP-dependent DNA helicase activity; protein binding; damaged DNA binding; protein N-terminus binding; transcription factor binding

Biological Process: DNA damage response, signal transduction by p53 class mediator; mitotic cell cycle checkpoint; positive regulation of kinase activity; isotype switching; DNA repair; positive regulation of protein amino acid autophosphorylation; DNA duplex unwinding; double-strand break repair via homologous recombination; regulation of DNA replication initiation; cell proliferation; meiotic cell cycle; double-strand break repair; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA damage checkpoint; blastocyst growth; cell cycle arrest; neuromuscular process controlling balance; telomere maintenance

Disease: Leukemia, Acute Lymphoblastic; Nijmegen Breakage Syndrome; Aplastic Anemia

Research Articles on NBN

Similar Products

Product Notes

The NBN nbn (Catalog #AAA6148483) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nibrin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NBN nbn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Nibrin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.