Mouse anti-Human SLC17A4 Monoclonal Antibody | anti-SLC17A4 antibody

SLC17A4 (Solute Carrier Family 17 Member 4, KAIA2138, Putative Small Intestine Sodium-dependent Phosphate Transport Protein) APC

Cat. Num. AAA6139087

• Gene Names: SLC17A4; KAIA2138
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC17A4; Monoclonal Antibody; SLC17A4 (Solute Carrier Family 17 Member 4; KAIA2138; Putative Small Intestine Sodium-dependent Phosphate Transport Protein) APC; anti-SLC17A4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3E4
• Specificity: Recognizes human SLC17A4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 3581

• Applicable Applications for anti-SLC17A4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa56-131 from SLC17A4 (NP_005486) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NLSIAIPAMVNNTAPPSQPNASTERPSTDSQGYWNETLKEFKAMAPAYDWSPEIQGIILSSLNYGSFLAPIPSGYV
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.1KD).)

Western Blot (WB)

(SLC17A4 monoclonal antibody Western Blot analysis of SLC17A4 expression in K-562)

Testing Data

(Detection limit for recombinant GST tagged SLC17A4 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-SLC17A4 antibody

Antibodies; Ion Transport

NCBI and Uniprot Product Information

• NCBI GI #: 1653960544
• NCBI GeneID: 10050
• NCBI Accession #: NM_005495.3
• NCBI GenBank Nucleotide #: NM_005495
• UniProt Accession #: Q9Y2C5
• NCBI Official Full Name: Homo sapiens solute carrier family 17 member 4 (SLC17A4), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: solute carrier family 17 member 4
• NCBI Official Symbol: SLC17A4
• NCBI Official Synonym Symbols: KAIA2138
• NCBI Protein Information: probable small intestine urate exporter
• UniProt Protein Name: Putative small intestine sodium-dependent phosphate transport protein
• Protein Family: Probable small intestine urate exporter
• UniProt Gene Name: SLC17A4
• UniProt Entry Name: S17A4_HUMAN

NCBI Description

Phosphate homeostasis is maintained by regulating intake, intestinal absorption, bone deposition and resorption, and renal excretion of phosphate. The central molecule in the control of phosphate excretion from the kidney is the sodium/phosphate cotransporter NPT1 (SLC17A1; MIM 182308), which is located in the renal proximal tubule. NPT1 uses the transmembrane electrochemical potential gradient of sodium to transport phosphate across the cell membrane. SLC17A4 is a similar sodium/phosphate cotransporter in the intestinal mucosa that plays an important role in the absorption of phosphate from the intestine (summary by Shibui et al., 1999 [PubMed 10319585]).[supplied by OMIM, Feb 2011]

Uniprot Description

Function: May be involved in actively transporting phosphate into cells via Na+ cotransport

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed intestine, colon, liver and pancreas. Ref.1

Sequence similarities: Belongs to the major facilitator superfamily. Sodium/anion cotransporter family.