Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human RHOT1 Monoclonal Antibody | anti-RHOT1 antibody

RHOT1 (Ras Homolog Gene Family Member T1, ARHT1, Mitochondrial Rho GTPase 1, MIRO1, MIRO-1, hMiro-1, Rac-GTP-binding Protein-like Protein) APC

Gene Names
RHOT1; ARHT1; MIRO1; MIRO-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOT1; Monoclonal Antibody; RHOT1 (Ras Homolog Gene Family Member T1; ARHT1; Mitochondrial Rho GTPase 1; MIRO1; MIRO-1; hMiro-1; Rac-GTP-binding Protein-like Protein) APC; EC=3.6.5.-; anti-RHOT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4H4
Specificity
Recognizes human RHOT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RHOT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa483-581 from human RHOT1 (NP_060777) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(RHOT1 monoclonal antibody, Western Blot analysis of RHOT1 expression in HeLa NE.)

Western Blot (WB) (RHOT1 monoclonal antibody, Western Blot analysis of RHOT1 expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged RHOT1 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RHOT1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-RHOT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
mitochondrial Rho GTPase 1 isoform 3
NCBI Official Synonym Full Names
ras homolog family member T1
NCBI Official Symbol
RHOT1
NCBI Official Synonym Symbols
ARHT1; MIRO1; MIRO-1
NCBI Protein Information
mitochondrial Rho GTPase 1
UniProt Protein Name
Mitochondrial Rho GTPase 1
UniProt Gene Name
RHOT1
UniProt Synonym Gene Names
ARHT1; MIRO-1; hMiro-1
UniProt Entry Name
MIRO1_HUMAN

Uniprot Description

RHOT1: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution. Belongs to the mitochondrial Rho GTPase family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric; Membrane protein, integral; Hydrolase; Mitochondrial; G protein, monomeric, Rho; EC 3.6.5.-; G protein

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: membrane; plasma membrane; cytosol; integral to mitochondrial outer membrane

Molecular Function: GTPase activity; protein binding; GTP binding; calcium ion binding

Biological Process: regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; cellular homeostasis; mitochondrion transport along microtubule

Research Articles on RHOT1

Similar Products

Product Notes

The RHOT1 rhot1 (Catalog #AAA6138728) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHOT1 (Ras Homolog Gene Family Member T1, ARHT1, Mitochondrial Rho GTPase 1, MIRO1, MIRO-1, hMiro-1, Rac-GTP-binding Protein-like Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOT1 rhot1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.