Estrogen Receptor Recombinant Protein | ER recombinant protein

Recombinant Human Estrogen Receptor Protein

Cat. Num. AAA9140245

• Gene Names: ESR1; ER; ESR; Era; ESRA; ESTRR; NR3A1
• Purity: >95% by SDS-PAGE.
• Synonyms: Estrogen Receptor; Recombinant Human Estrogen Receptor Protein; ER-Alpha; Estradiol Receptor; Nuclear Receptor Subfamily 3 Group A Member 1; ESR1; ESR; NR3A1; ER recombinant protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 uM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ
• Sequence Length: 595

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
• Tag: 6xHis tag at the N-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Estrogen Receptor Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Related Product Information for ER recombinant protein

Description: Recombinant Human Estrogen Receptor Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Gln116) of human Estrogen Receptor (Accession #P03372) fused with a 6xHis tag at the N-terminus.

Background: Estrogen Receptor is a major ligand--?activated transcription factor belonging to the nuclear hormone receptor superfamily. Estrogen Receptor is composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but they also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.

Product Categories/Family for ER recombinant protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 62821794
• NCBI GeneID: 2099
• NCBI Accession #: NP_000116.2
• NCBI GenBank Nucleotide #: NP_000116.2
• UniProt Accession #: P03372
• NCBI Official Full Name: estrogen receptor isoform 1
• NCBI Official Synonym Full Names: estrogen receptor 1
• NCBI Official Symbol: ESR1
• NCBI Official Synonym Symbols: ER; ESR; Era; ESRA; ESTRR; NR3A1
• NCBI Protein Information: estrogen receptor
• UniProt Protein Name: Estrogen receptor
• Protein Family: Estrogen receptor
• UniProt Gene Name: ESR1
• UniProt Synonym Gene Names: ESR; NR3A1; ER
• UniProt Entry Name: ESR1_HUMAN

NCBI Description

This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Mar 2014]

Uniprot Description

ER-alpha: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: nucleoplasm; Golgi apparatus; membrane; cytoplasm; plasma membrane; integral to membrane; nucleus

Molecular Function: identical protein binding; estrogen receptor activity; zinc ion binding; nitric-oxide synthase regulator activity; beta-catenin binding; estrogen response element binding; transcription factor binding; steroid binding; protein binding; enzyme binding; steroid hormone receptor activity; chromatin binding; transcription factor activity

Biological Process: estrogen receptor signaling pathway; positive regulation of nitric oxide biosynthetic process; uterus development; signal transduction; response to estradiol stimulus; regulation of apoptosis; positive regulation of fibroblast proliferation; elevation of cytosolic calcium ion concentration; regulation of transcription, DNA-dependent; epithelial cell development; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; antral ovarian follicle growth; positive regulation of nitric-oxide synthase activity; negative regulation of transcription factor activity; male gonad development; androgen metabolic process; vagina development; positive regulation of retinoic acid receptor signaling pathway; negative regulation of I-kappaB kinase/NF-kappaB cascade; chromatin remodeling; response to estrogen stimulus; gene expression; positive regulation of transcription factor activity; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling

Disease: Breast Cancer; Migraine With Or Without Aura, Susceptibility To, 1; Myocardial Infarction, Susceptibility To; Estrogen Resistance